KEGG   Actinoalloteichus hoggarensis: AHOG_16080Help
Entry
AHOG_16080        CDS       T04975                                 

Gene name
aml
Definition
(GenBank) Alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00500  Starch and sucrose metabolism
ahg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AHOG_16080 (aml)
Enzymes [BR:ahg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AHOG_16080 (aml)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C DUF1968
Motif
Other DBs
NCBI-ProteinID: ASO20842
UniProt: A0A221W4N0
LinkDB All DBs
Position
complement(3788050..3789810)
Genome map
AA seq 586 aa AA seqDB search
MRSSSASTRRTGPGRLLAGLLAGVLAASTATTVPVAAAAEPAAPPGARDVTAVLFEQTFA
SVARACTEVLGPKGYGHVQVSPPQERIQGPQWWTAYQPVSYRIAGPLGDRAAFQSMISTC
GDAGVGVIVDAVVNHMSAGSGIGTGGTRYTKYDYPGHYQNQDFHGCRQPITDYRNRYDVQ
QCELVGLSDLNTGSDYVRSEIAEYLDDLISMGVAGFRVDAVKHMATDDLRAIKNRLSNPD
VYWVQEAVYGADEAVSPGEYLQNGDVQEFRYATDLKRVFTNENLAYLENYGEAWGYLPSE
QSGVFVANHDTERNGSTLSYRDDAAYTLAHVFMLAHPYGTPSVHSGYEFSDYDAGAPGGG
NVGACYHDGWSCQHAWPQIANMVGFRNAAGDAGVTNWWDDGADAIAFGRGDRAFVAINHE
GASITRTFQTSLPAGTYCDVQHGDPVPGGGCTGTTYTVGGDGRFTATVGAGDAVALHVGA
TAAPGPGPGQTGATFSVTATTTWGENIFVVGDHAALGAWNPAAAVPLSSAGYPVWTGEVS
VPAGTVLRYKYLRKDSNGVVTWENGADRSATVPATGMVRTTDAWRG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgagatcgagttccgcttccacccggcgcaccgggccaggtcgattactggccggcctg
cttgcaggcgtgctggccgcgtcgacggccaccacggtgcccgtcgcggccgcggccgag
cccgcggcgccgcctggcgccagggacgtcaccgccgtcctcttcgaacagaccttcgcg
tcggtggcgcgcgcctgcaccgaggtcctcggaccgaagggctacggtcacgtgcaggtc
tccccgccacaggagcgcattcagggaccgcagtggtggaccgcctaccagcccgtgagc
taccgcatcgccgggccgctcggtgaccgggcggcgttccagtcgatgatctccacctgt
ggcgacgcgggcgtcggcgtgatcgtcgacgccgtcgtcaaccacatgtccgccggatcc
ggcatcgggacgggcgggacccgatacacgaagtacgactaccccggccactaccagaat
caggacttccacggctgtcggcagccgatcaccgactaccggaatcggtacgacgttcag
cagtgcgaactggtgggcttgtcggatctgaacaccggcagcgactatgtgcgctccgag
atcgccgagtacctcgacgatctgatctcgatgggcgtcgcgggctttcgcgtcgacgcg
gtgaagcacatggcaaccgacgacctccgcgccatcaagaacaggttgtcgaatccggac
gtctactgggttcaggaggccgtctacggcgcggatgaggcggtgagccccggcgagtac
ctccagaacggagacgtgcaggagttccgctacgccaccgacctcaagagggtcttcacg
aacgagaacctggcgtatctcgagaactacggcgaagcctggggatacctgccgtccgaa
cagtccggtgtgttcgtcgccaatcacgacaccgagcgcaacggatcgaccctgagctat
cgtgacgacgcggcctacaccctggcccacgtgttcatgctggcccacccctacggcact
ccctcggtgcactccggctacgagttctccgattacgatgcaggcgcgccgggtggcggg
aacgtcggcgcctgctaccacgacggctggagttgccagcatgcctggccgcagatcgcc
aacatggtcggcttccgcaacgccgcaggcgatgcgggcgtcacgaactggtgggacgac
ggggccgacgcgatcgccttcggccgtggggatcgagccttcgtggcgatcaaccacgag
ggcgcgagcatcacccggacgttccagacgtcgctgcccgccggaacctactgcgacgtc
cagcacggcgaccccgttcccggcggcggctgtaccgggacgacctacaccgtgggtggc
gacgggcggttcaccgcgacggtcggcgcgggagacgccgtggccctgcatgtcggcgcc
acggccgcgccggggcccgggcccggccagaccggcgcgacgttcagcgtgaccgcgacg
acgacctggggcgagaacatcttcgtcgtcggggatcacgcggccctcggcgcgtggaat
ccggcggcggcggtgccgctgtcctccgcgggttatccggtctggaccggggaggtctcg
gtgcccgccgggaccgtgctgcggtacaagtacctgcgcaaggactcgaacggcgtcgtc
acctgggagaacggcgcggatcgaagtgccaccgtgcccgcgaccgggatggtgcggacc
accgacgcctggcgcggctga

DBGET integrated database retrieval system