KEGG   Actinoalloteichus hoggarensis: AHOG_20405Help
Entry
AHOG_20405        CDS       T04975                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AHOG_20405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahg03400]
    AHOG_20405
Enzymes [BR:ahg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AHOG_20405
DNA repair and recombination proteins [BR:ahg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AHOG_20405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ASO21698
UniProt: A0A221W720
LinkDB All DBs
Position
complement(4827595..4828596)
Genome map
AA seq 333 aa AA seqDB search
MAQDSVGGRAEPLPAVRPMLATGGQPLPAGRGWAWEFKFDGIRAVAAGDRNGIRLTSRNG
NDITATYPELTVLGEALGSHRAVLDGEIVALDADGRPSFPLLQRRMHVRRPTARLTGEIP
VACYVFDLLHLDGVSLLAEPYHRRRELLDELRLEGRTARVRVPPSRQDVDPRLLLDVARD
NGLEGVIGKRLDSGYRPGYRSRDWLKFPLINTYEVVICGWQPGSGRRAGRIGSLILGAHD
PAGGLRYVGHVGTGFTERMLTELLGLLQPIERSTSPFVGPVPKEYSRDAHWVEPRLVGEV
VYRTWSPDRRLRHSAWRGLRPDRDAHEISLPTE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggacagcgtgggcggccgagccgaaccgcttcccgccgttcggccgatgctc
gccacgggcgggcagccgctgcccgcggggcggggctgggcgtgggagttcaagttcgac
ggaattcgggccgtcgccgcgggcgatcggaacggcatccggctgaccagccgtaacggc
aacgacatcacggcgacctacccggagctgaccgtactcggcgaggccctcggctcccac
cgtgccgtgctcgacggcgagatcgtcgccctggacgccgacggcaggccctcgttcccg
ctgctgcaacgtcggatgcacgtccgacgaccgacggcccggctgaccggtgagatcccg
gtcgcctgctacgtgttcgacctgctccacctcgacggcgtctccctgctcgccgagcct
taccaccgtcgacgggagctgctcgacgagctgcgactggagggtcggaccgcgcgagtc
cgggtgccgccgagtcgtcaggacgtcgacccgaggctgttgctcgacgtcgcacgagac
aacgggctggagggcgtgatcggcaaacgcctcgactccggctatcggccggggtatcgc
agccgggactggctgaagttcccactgatcaacacctatgaagtggtgatctgcgggtgg
cagccgggctccgggcggcgagccgggcggatcggctcgctgatcctgggcgcgcacgac
cccgcaggcgggctgcgctatgtggggcacgtcggaaccgggttcaccgagcggatgctg
accgagctgctcgggctgctccagccgatcgaacgctcgacgagccccttcgtcgggccg
gtgccgaaggagtactcccgcgacgcgcactgggtggagccccggctcgtcggggaggtc
gtctatcggacgtggagccccgaccgcaggctgcggcactccgcctggcggggcctgcgc
cccgaccgggacgcccacgagatcagccttcccacggagtag

DBGET integrated database retrieval system