KEGG   Actinoalloteichus hoggarensis: AHOG_21800Help
Entry
AHOG_21800        CDS       T04975                                 

Gene name
bgaB2
Definition
(GenBank) Beta-galactosidase bgaB
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AHOG_21800 (bgaB2)
Enzymes [BR:ahg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AHOG_21800 (bgaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4350 Cellulase DUF4159
Motif
Other DBs
NCBI-ProteinID: ASO21976
UniProt: A0A221W8Q7
LinkDB All DBs
Position
complement(5129639..5131801)
Genome map
AA seq 720 aa AA seqDB search
MSTDLAALRRRLGGLAYGCDYNPEQWPEEVWAEDMRLMRQAGVNLVSIGIFSWAKIEPRP
GEYDFGWFDRLMDLLAANGIGACLATMTASPPPWMARLHPETLPVTATGVRLAPGSRQQF
CPSSRVYRDYATRLVEQIATRYRDHPALALWHVNNEYGCHMNACYSDVSAAAFRDWLRDR
YGDLDRLNEAWYTDFWSQGYTDWADIGVPSLAPYHPNPGQSIDFARFTSDAFLGCFLAEK
EVLSRVTPDIPVTTNFITDGPSIDLFDWAGHQDLIAFDSYPDPFEADAHVAAAFHYDLMR
SLRHGQPWFLMEQATAAVNWRERNAMKPPGAMRLGSWQAVAQGADAVMFFQWRASRGGTE
KFHAAMVPHTGTETRIFREVCELGRELASVPELVDSRVRADTALLLDWSNWWALERDSHP
SVDVTRREAETAHYTPLFEAGVTCDVVHPDRDLSGYRLVVVPNLYLLSDAAAERLRDYVR
GGGHLVVSFFSGVVDENDHVHQGGMSRALRETLGLWVEEYWPLPAAGTVAVTGLGPDRLA
APAGVDAATTAALASVSTIGAAAGAAVVVSPNDAAVASPPVRGRIWSELIRLEGAESLAE
FAEGELRGSPAVTRHAFGAGTAWYLGTRLDGDAMRELLAAVCAAADVGPDLALPPGVQAV
TRHTPDGDRLLLLLNHGGESARVALPDPMVDVLTSGAEAEPSSDVLLPRHGVAVLRRAPA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggatctggccgcgctgcgtcgacggctcggcggcctggcctacggctgtgac
tacaaccccgagcagtggccggaggaggtctgggccgaggacatgcggctgatgcggcag
gccggggtgaacctggtcagcatcggcatcttctcctgggcgaagatcgagcccaggccg
ggcgagtacgacttcggctggttcgaccggctgatggacctgctggcggccaacggcatc
ggcgcgtgcctggcgaccatgacggcctcgccgccgccgtggatggcccggctgcatccc
gagacactgccggtcacggccaccggagtccggctggccccgggttcccgccagcagttc
tgtccgtcgagccgggtctaccgcgactacgccacccggctcgtggagcagatcgccacc
cgctatcgggatcacccggccttggcgctgtggcacgtcaacaacgagtacggctgccac
atgaacgcctgttactcggacgtctcggccgccgcgttccgggactggctccgcgaccgc
tacggggatctcgatcgactcaacgaggcgtggtacaccgacttctggtcgcagggttac
accgactgggccgacatcggggtgccgagcctggcgccgtaccacccgaacccggggcag
agcatcgacttcgcccgcttcacctcggacgccttcctcggctgcttcctcgccgagaag
gaggtgctctcccgagtgaccccggacatcccggtgacgaccaacttcatcaccgacggc
ccgtcgatcgacctgttcgactgggcggggcaccaggacctcatcgccttcgactcctac
ccggacccgttcgaggccgacgcccacgtcgccgcggcgttccactacgacctgatgcgc
tcgctgcgtcacggacagccgtggttcctcatggagcaggcgacggcggccgtgaactgg
cgggagcgcaacgccatgaagccgccgggcgcgatgcggttgggcagctggcaggccgtc
gcgcagggcgccgacgcggtgatgttcttccagtggcgcgcctcgcgaggcggcaccgag
aagttccacgccgcgatggtcccccacaccggcaccgagacgaggatcttccgggaggtc
tgcgagctggggcgcgaactggcctcggtgccggagctcgtcgacagcagggtccgggcc
gacaccgcgttgctgctggactggtcgaattggtgggcgctggagcgcgactcccatccc
agcgtcgacgtcacgcggcgcgaggccgagacggcgcactacaccccgctgttcgaggcg
ggggtgacctgcgacgtcgtgcatccggaccgcgacctgtccggctatcggctggtggtc
gtgccgaacctgtatctcctgagcgacgcggccgccgaacggctccgggactacgtccgg
ggcggcgggcatctcgtcgtctcgttcttctccggcgtcgtcgacgagaacgaccacgtg
catcagggcgggatgtcgcgggcgctgcgggagaccctgggcctgtgggtggaggagtac
tggccgctgcccgcggccgggaccgtcgccgtcaccgggctcggcccggaccggctcgcg
gcgcccgccggggtcgatgcggcgacgacggcggcactcgcctccgtctcgacgatcggc
gcggcggcgggggcggcggtcgtggtgtcgccgaacgacgccgcggtggcgagtccaccg
gtgcggggccggatctggtcggagctgatcaggctggagggcgccgagtcgctggcggag
ttcgccgagggagagctgcgcggctcgcccgcggtcacgcgacacgccttcggcgcgggc
accgcctggtatctcggcacccggttggacggcgacgcgatgcgggagctgctggccgcc
gtctgcgccgcggcggacgtcggacccgatctcgcgctgccgcccggcgtgcaggccgtc
acccgccatactccggacggggatcggctcctgctgctgctcaatcacggcggcgagtcg
gcgcgggtcgccctgcccgacccgatggtcgacgtcctgacctccggcgccgaggcggag
ccctcgtccgacgtcctgctgcccaggcacggagtcgcggtgctgcggcgcgccccggcc
tag

DBGET integrated database retrieval system