KEGG   Actinoalloteichus hoggarensis: AHOG_24880Help
Entry
AHOG_24880        CDS       T04975                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00564  Glycerophospholipid metabolism
ahg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AHOG_24880 (glpD)
Enzymes [BR:ahg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AHOG_24880 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox 3HCDH_N Pyr_redox_3 Thi4 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: ASO22581
UniProt: A0A221WA33
LinkDB All DBs
Position
complement(5881806..5883587)
Genome map
AA seq 593 aa AA seqDB search
MAKQSDQSPAAENSRLAATEAQALMEAGALTPAERRRNWSRLGSESFDVVVVGGGVTGAG
VALDAATRGMRVALVEARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTR
IAPHLVKPVPFLYPLSHRIWERPYTAAGLLLYDTMGGARSVPGQKHLTRAGALRLFPALK
RDALIGGIRYFDSQADDARHTMTVARTAAHYGAVVRTSTQVVGFLREADRVSGVRVRDVE
TGDEVDVTAQTVVNATGVWTDELQRLSGSRGRFRVKASKGVHIVVPRDRIVAEAGLILRT
EKSVLFVIPWRNHWIIGTTDTEWNLDLAHPAATERDIDYILDHVNQVLATPLVPEDIEGV
YAGLRPLLTGESEDTSKLSREHAVARVAPGMVAIAGGKYTTYRVMAADAVDAVAADLPGR
SASSITDKVPLLGADGYHALVNQADQLAARHGLHPYRVRHLLDRYGSLIHQVLAQAAGRP
DLLRPIPSAPDYLQVEVVYAAGYEGALHLEDVLTRRTRISIEYPHRGIECAETVARLMGE
VLGWDDARAAEEIRIYTARVDAERDSQSQPDDLAADERRSAAPEARPEIQEPA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagcagtccgaccagagcccggcggccgagaacagcagacttgccgcaaccgag
gcgcaggccctcatggaggcgggcgcgctgaccccggcggaacgacgtcgaaactggtca
cgactcggctcggagagcttcgacgtcgtggtggtcggcggcggcgtcaccggcgcgggc
gtcgcgctcgacgcggcgaccagaggtatgcgtgtcgcgctcgtcgaggcgcgtgacctc
gcgtcgggcacgtcgagtcggtccagcaagctctttcacggcggtctccgctacctcgaa
cagctggagttcggtctggtccgggaggctctgcgcgagcgggagctgatgctgaccagg
atcgccccgcacctggtcaagccggtgccgttcctgtacccgctgagccaccggatctgg
gaacgcccctacaccgccgcgggtctgctcctctacgacacgatgggcggcgcccgttcc
gtgcccggtcagaagcacctgaccagggcgggggcgctgcggctgttccccgcgctcaag
cgcgacgccctgatcggcggcatccgatacttcgacagccaggccgacgacgcacggcac
acgatgaccgtcgccaggaccgcggcgcactacggtgcggtggtccggacctccacgcag
gtggtgggcttcctcagagaggcggaccgagtctccggcgtccgggttcgcgacgtggag
accggcgacgaggtcgacgtgaccgcacagaccgtcgtcaacgccacgggggtgtggacc
gacgaactccagcggctctcgggcagtcgaggccggttccgcgtcaaggccagcaagggc
gtgcacatcgtcgtcccgcgcgaccgcatcgtcgccgaggcggggctgatcctgcggacc
gagaagtccgtgctcttcgtcatcccctggcgcaaccactggatcatcggcaccaccgac
accgagtggaacctcgacctcgcccacccggcggcgaccgagcgcgacatcgactacatc
ctcgatcacgtcaaccaggtgttggcgacgccgctggtcccggaggacatcgagggcgtc
tacgcgggcctccgcccgctgttgaccggcgagagtgaggacacctcgaagctctccagg
gagcatgcggtggcgcgggtcgcaccgggcatggtcgccatcgcgggcgggaagtacacc
acctaccgtgtgatggccgccgacgcggtcgacgcggtggctgccgacctgcccgggcgc
agcgcctcctcgatcaccgacaaggtcccgctgctcggggccgacggctaccacgcgctg
gtgaaccaggccgatcaactcgccgcccggcacggtctgcatccctaccgggtgcgtcac
ctgctcgaccgctacggctcgctgatccaccaggtgctggcgcaggccgccggccgtccc
gatctcctgcggccgatcccctcggcgccggactacctccaggtcgaggtcgtctacgcc
gcaggctacgagggtgcgctgcacctggaggacgtgctcacccggcggacgaggatctcg
atcgaatacccgcatcgcggcatcgagtgcgccgagaccgtggcgcggctgatgggcgag
gtgctcggctgggacgacgcgcgggcggccgaggagatccggatctacacggcgcgggtc
gacgcggagcgggactcgcagagtcagcccgacgacctggccgccgacgaacgtcggtcg
gcggcgcccgaggcgaggccggagatccaggaacctgcctga

DBGET integrated database retrieval system