KEGG   Actinoalloteichus hoggarensis: AHOG_25170Help
Entry
AHOG_25170        CDS       T04975                                 

Gene name
pknA4
Definition
(GenBank) Serine/threonine-protein kinase PknA
Organism
ahg  Actinoalloteichus hoggarensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ASO22639
UniProt: A0A221WAV4
LinkDB All DBs
Position
5950966..5952918
Genome map
AA seq 650 aa AA seqDB search
MPTRRTPPPDGDRLIAGRYRLHQLLGRGAMGTVWAAYDEFLHRQVAVKEVLLPVGIPAAA
ADELRERTMREARANAVLSHPNVVTLFDVARHDGEPFVVSELVPSNSLAEVLTRHGMLAA
PEAALVADSVAAALEAAHRAGITHRDVKPGNVLVGRDGQIKLTDFGIARNVAETTLTATG
LMLGTPSYIAPEVASGGEVTPAADLWALGATLFAAVEGRPPYSSGGDPVATVFEVVHGAV
PQPTCGGPLAPLISGLMVKDAALRLPLAEVRRRLAPLLPASTAGISALLDSDDPDFSEDS
DLDDTHDSHDAYVDDDEQASDAGVPDAGAPDEEPAARREPGPDEPPAAPEVTAEVPRVEG
EDVTESDTVIIRRPAQAAVPHTPLASDPGPLPFAASPQAPRHPRTRTAPSGTRLGAATPA
RPRRARGLTTLLLAAALFLGAAAVGFAVIRTLAGETLQPSSGRDAEGSRDPGLPEPDYER
RTDTAAASGDPASSVAGRYTVDVPRDWLTFYEHRDDALGESVLHRHLAPDGSRMISVQRF
VGFYPDSGVTDYLAYLTTTSTSSNGELLMQGDSVLATHPDGAEPDRAISYRMVDRGLTSN
AHQGELRRSTFAGLRPRGDDLWVVSVTVPTDTEGAGSRIFERVSDGFTLR
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaccagacgcaccccgccgccggacggcgaccgcctcatcgccggacggtatcgc
ctgcatcagctcctgggcaggggggcgatgggcacggtgtgggccgcctatgacgagttc
ctgcatcggcaggtggcggtcaaggaggtgctccttcccgtgggcatcccggcggccgcg
gccgacgagctgcgcgagcggaccatgcgcgaggcgcgggccaacgccgtgctctcccat
cccaacgtggtcacgctgttcgacgtggcccgccacgacggcgagccgttcgtcgtctcg
gaactcgtgccgagcaacagcctggcggaggtcctgacgcggcacggcatgctcgcggcg
ccggaggcggcgctggtcgccgactcggtggccgccgcgttggaggccgcgcatcgggcg
gggatcacccatcgcgacgtgaaaccgggcaacgtgctggtcggccgggacggccagatc
aagctcaccgacttcggcatcgcccgcaacgtcgcggagaccacgctcaccgcgacgggc
ctcatgctgggcactcccagctacatcgccccggaggtcgcctccggcggcgaggtcacg
cccgccgccgacctgtgggccctgggcgccacgctcttcgccgcggtcgagggtcgcccg
ccgtactcctcgggcggcgatccggtcgccaccgtgttcgaggtggtccacggcgccgtg
ccgcagccgacgtgcggcggcccgctggccccgctgatcagcgggctgatggtcaaggac
gccgcattgcgtctgccgctggccgaggtgcgccgcaggctcgcgccgctgctgcctgcc
tccacggcgggcatctcggcgctgctcgacagcgacgaccccgacttcagcgaggactcc
gatctcgacgacacccacgactctcatgatgcctacgtcgacgacgacgagcaggcgtcc
gacgccggggtgcccgacgccggggcgcccgacgaggagcctgcggcgcggcgggagccg
gggccggacgagccgcccgccgcccccgaggtcaccgccgaggtgcccagggtcgagggc
gaggacgtcaccgagtcggacacggtgatcatccggcgtcccgcgcaggctgccgtgccg
cacacgccgctggccagcgatcccggcccgctgcccttcgccgcgtcgccgcaggcgccg
cggcatccccgtacccggaccgccccgtcggggacgaggctcggcgcggccacgcccgcc
cgcccgcgccgagcccgcgggctgacgacgctgctgctggcggccgcactgttcctcggc
gccgcggccgtaggcttcgccgtgatcaggacgctggcgggcgagaccctgcagccgtcg
agcggccgggacgccgagggctctcgcgaccccggcctgcccgaacccgattacgaacga
cgcaccgacaccgccgcggcgagcggggacccggcgagctccgtcgccgggcggtacacg
gtggacgtgccgagggactggctcaccttctacgagcatcgcgacgacgccctcggcgag
agcgtcctgcatcggcatctggccccggacggcagccggatgatctccgtgcagcgtttc
gtcgggttctaccccgactccggggtcacggactacctcgcgtatctcacgacgacgtcg
accagcagcaacggtgaactgctgatgcagggcgactcggtgctcgcgacccatccggac
ggcgcggagccggaccgggcgatcagttatcgcatggtggaccgggggctgacgagcaac
gcccaccaaggcgagctgcggcgtagcacgttcgcgggtctccgccctcgcggcgatgat
ctgtgggtggtgtcggtgacggtgcccaccgacacggagggggcgggcagccgcatcttc
gagcgggtctcggacggcttcacgctgcgctga

DBGET integrated database retrieval system