KEGG   Actinoalloteichus hoggarensis: AHOG_25420Help
Entry
AHOG_25420        CDS       T04975                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00020  Citrate cycle (TCA cycle)
ahg00480  Glutathione metabolism
ahg01100  Metabolic pathways
ahg01110  Biosynthesis of secondary metabolites
ahg01120  Microbial metabolism in diverse environments
ahg01130  Biosynthesis of antibiotics
ahg01200  Carbon metabolism
ahg01210  2-Oxocarboxylic acid metabolism
ahg01230  Biosynthesis of amino acids
Module
ahg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHOG_25420 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AHOG_25420 (icd)
Enzymes [BR:ahg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AHOG_25420 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASO22689
UniProt: A0A221WB02
LinkDB All DBs
Position
complement(6001219..6002436)
Genome map
AA seq 405 aa AA seqDB search
MGKIKVQGKVVELDGDEMTRIIWQFIKDRLVHPYLDVDLEYYDLGIESRDATDDQITIDA
ANAIAKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIIENIPRL
VPGWTKPIIIGRHAHGDQYKASDFKVPGPGTVTISYTPADGSEPLELEVAQFPEGGGVAI
GMYNYRKSIEDFARASLAYGLQRGYPVYMSTKNTILKAYDGMFKDVFEEIFEKEFKAEFD
KQGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHYRQHQQGRPTSTNPIASIFAWSRGLAHRGKLDSTPEVIGFAQSLE
QVVIETVESGKMTKDLALLVGKDQAFQTTEEFLASLDENLAKKLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtacagggcaaggtcgtcgagctcgacggcgacgagatgaccagg
atcatctggcagttcatcaaggaccggctggtccacccctatctcgatgtggacctggag
tactacgacctcggcatcgagagccgcgacgccacggacgaccagatcaccatcgacgcg
gccaacgcgatcgcgaagcacggcgtcggcgtgaagtgcgccaccatcacgccggacgag
gccagggtcgaggagttcggcctcaagaagatgtggcgcagccccaacggcaccatccgc
aacatcctcggcggcgtcgtcttccgcgagccgatcatcatcgagaacatccctcggctc
gtgcccggctggaccaagccgatcatcatcggcaggcacgcgcacggtgaccagtacaag
gccagcgacttcaaggtccccggcccgggcaccgtgacgatcagctacacgcctgccgac
ggcagcgagccgctggagctggaggtcgcgcagttccccgagggcggcggcgtcgccatc
ggcatgtacaactaccggaagtcgatcgaggacttcgctcgggcgtcgctggcctacggt
ctccagcgcggttacccggtctacatgtccaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatcttcgagaaggagttcaaggccgagttcgac
aagcaggggctcacctacgagcaccggctgatcgacgacatggtcgcggccgcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctcggtgctgatgactccggacggc
cgcacggtcgaggccgaggccgcgcacggcacggtcacccggcactaccggcagcaccag
cagggcaggccgacgtcgaccaacccgatcgcgtcgatcttcgcgtggagccggggtctg
gcgcaccggggcaagctcgactcgacccccgaggtgatcgggttcgcccagagcctggag
caggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgccctgttggtc
ggcaaggaccaggccttccagaccaccgaggagttcctcgcgagcctggacgagaatctg
gcgaagaagctggcctag

DBGET integrated database retrieval system