KEGG   Actinoalloteichus hoggarensis: AHOG_26430
Entry
AHOG_26430        CDS       T04975                                 

Gene name
ptlI2
Definition
(GenBank) Pentalenene oxygenase
Organism
ahg  Actinoalloteichus hoggarensis
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ASO22891
UniProt: A0A221WB10
LinkDB
Position
6247994..6249352
AA seq 452 aa
MTVDHIPSASGLPVIGSMLELRRGALQAYERARAEHGDVVRFIAGPPGLRATFYAVFSPQ
GAQEVLATKAADFGKDNQFYQEAREALGNGLLTSQHEDYQRQRRLIQPLFTPRRVDLYAQ
AIREEAGRMTTGWADAQDGVVDVLGETSRFALRTVSRVLFGADAGEMIPAVRRCFPILST
HTQRRGFAPRNVPRNWPTPANLKADAAQAELYEVCDQIIAARDRQQQPTETGTDLLAQLT
GAEGADGERLDPVEIREHVLIFLLAGHETTATALAFALHLLARHPAEQAEARAEVDRVLG
GAEPQAADVDRLPYLTMVLKEAMRLYPPAPAVGRRNKIAVEVDGRRIPAGSDVILVQWAL
HRHPDHWEDPERFDPTRFTEEKESARHRYAWLPFGGGPRACIGRRFAMLESVLALATVLR
GHRIEAVDVDVPVEQGTTISVRGPMRCRVVPR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgaccgtcgaccacattccaagcgcgagcggactgccggtgatcggctcgatgctcgaa
ctccggcgaggcgcgctgcaagcctacgagcgggcccgcgccgagcacggtgacgtcgtc
cgcttcatcgcgggcccgccaggcctgcgcgccaccttctacgcggtcttctccccgcag
ggagcacaggaggtgctcgcgaccaaggccgccgatttcggcaaggacaaccagttctat
caggaggcgcgagaggctctcggcaacgggctgctcaccagccagcatgaggattaccaa
cggcagcgacggctcatccagcccttgttcaccccccgccgggtcgacctctacgcacag
gcgatccgcgaggaggccgggcggatgacgacgggatgggcggacgcccaggacggggtc
gtcgacgtgctcggcgagaccagccgattcgccctccgcaccgtgagccgcgtcctgttc
ggcgccgacgccggcgagatgatccccgccgtgcgtcgatgcttcccgatcctgtccacc
catacccagcggcgcggcttcgcgccgcggaacgtgcccaggaactggccgacgcccgcc
aacctcaaggccgacgcggcgcaggccgaactgtatgaggtctgtgatcagatcatcgcg
gcccgggatcggcagcagcagcccactgagacgggcaccgacctgctggctcagctcacc
ggcgcggaaggcgccgacggggagcggctcgatcccgtggagatccgcgaacacgtcctc
atcttcctgctcgccgggcacgagacgacggccaccgcactcgccttcgccctgcacctg
ctggcgcgacaccccgccgagcaggccgaggccagggccgaggtcgaccgggtgctcggc
ggcgccgagccccaggccgccgacgtcgaccggctgccctacctgacgatggtcctgaag
gaggccatgcgactgtatccgcccgcgcctgccgtgggccgccgcaacaagatcgccgtc
gaggtggacggccggcggattcccgcgggctccgacgtgatcctcgttcagtgggctctc
caccggcatcccgaccactgggaagacccggaacgcttcgacccgacgcggttcaccgag
gagaaggagtcggcccgacaccggtacgcctggctgcccttcggcggcggccccagggcg
tgcatcggcaggcggttcgccatgctggagtcggtgctcgcgctggcgacggtcctgcgt
ggccaccgcatcgaggccgtcgacgtcgacgtccccgtggaacagggcaccaccatcagc
gtgcgcggcccgatgcgctgccgagtcgtcccacgctga

DBGET integrated database retrieval system