KEGG   Aeromonas hydrophila AL06-06: RY45_07385Help
Entry
RY45_07385        CDS       T03748                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ahh  Aeromonas hydrophila AL06-06
Brite
Enzymes [BR:ahh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RY45_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJQ53919
UniProt: Q93FE7
LinkDB All DBs
Position
complement(1588068..1588652)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGIFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAITKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
TLVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaactctggaataccaccacggcaagcaccacaacacctatgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggcggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtggcgagcccactggcgccctggccgatgccatcaccaaggcc
ttcggctccttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaacttcggt
tccagctggacttggctggtgaaaaaggctgacggctccctggccatcgtcaacacctcc
aacgccggttgcccgctgaccgaagccggtaccactccgctgctgaccgtcgacctgtgg
gaacacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaaccttctgg
accctggtcaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system