KEGG   Aeromonas hydrophila AL06-06: RY45_09450Help
Entry
RY45_09450        CDS       T03748                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ahh  Aeromonas hydrophila AL06-06
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RY45_09450
Enzymes [BR:ahh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RY45_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin FMN_bind NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJQ54296
LinkDB All DBs
Position
complement(2036670..2038250)
Genome map
AA seq 526 aa AA seqDB search
MLDTNLKQQLNGYLQYIVNPIEISVSGNDSDKSAELLALATEISEMSPKIAMTDGTAARK
PSMSVAPKGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADAAVQEQIRNLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGAAERKAQELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEATKADAVTA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggataccaacctcaaacaacaactcaacggttacttgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaatgacagcgacaaatccgccgaactgctggcattggcc
acagagatcagcgagatgtcccccaagattgccatgacagatggcactgccgcccgcaag
ccttccatgagcgtcgcaccgaagggccaggccccgcgcgttcattttgccggcatcccc
atgggtcatgaatttacctcgctggtgcttgccctcctgcaaagcggcggtcacccctcc
aaggccgatgcggccgtgcaggagcagatccgcaacctcaagggcgagttccacttcgag
acttacatttcgctctcctgccacaactgcccggacgtggtgcaggcgctgaacctgatg
gccaccctgaaccccggcatcacccacaccatgatcgacggtgccctgttccaggacgag
gtcaacgagcgtcagatcatggcggtaccgaacgtctacctgaacggtcagccgttcagc
cagggccgcatttcgctcgaagagatcgtcgccaagctcgacaccggcgccgccgaacgc
aaggcgcaagagctgagcgaaaaagccccttacgacgtgctggtcgtcggtggtggcccg
gctggcgccgccgccgccatatatgccgctcgcaaaggcattcgcaccgccatcgtcgcc
gagcgtttcggtggccaggtgatggacaccgtcggcatcgagaacttcatctccgtgccc
tacaccgaaggccccaagctggccgccagcctggagcagcacgtcaagcagtacggcgtg
gaagtgatcaccgagcagcgcgccgccgccatcagcaaggatgggtatgtgaacgtggat
ctcgcctctggcgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgtgacctgaacgtgccgggcgagctcgagtaccgcaccaagggcgtggcctactgcccg
cactgtgacggccccttcttcaagggcaagcgggttgcggtgatcgggggcggcaactcc
ggcatcgaggcggccatcgatctggccggcattgtcgagcacgtcaccgtggtggagttc
gccgacaccctgcgtgccgatgaggtgttgcagaagaaggcccgctccatgggcaacatc
gacatcatcatgagcgcccgcaccaccgaagtgatcggtgatggcagcaaggtggtgggc
atggattacgaagatcgcaccaccggtgagatcaagcatctggctgtggcgggtatcttc
gtccagatcggtctggtgccgaacaccgagttcctcaaggggagcgaagtggccctgacc
cgctttggcgagatcgagatcgacaccaagggcgctacctccctgcccggcgtctacgcc
gcaggggacgccaccacggtgccgttcaagcagatcatcatctccatgggcgccggggcg
accgccgcactgggagcgtttgattacctcattcgcaatccggcgccggaagcgaccaaa
gctgacgccgtcaccgcctga

DBGET integrated database retrieval system