KEGG   Aeromonas hydrophila AL06-06: RY45_10835Help
Entry
RY45_10835        CDS       T03748                                 

Definition
(GenBank) acetyltransferase
Organism
ahh  Aeromonas hydrophila AL06-06
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_9 Acetyltransf_8 Acetyltransf_6 Acetyltransf_4 Acetyltransf_CG PanZ
Motif
Other DBs
NCBI-ProteinID: AJQ54551
LinkDB All DBs
Position
2359761..2360252
Genome map
AA seq 163 aa AA seqDB search
MTLIRACTLQDMAGLLALYRELRPHDPALAPDVARTALTALLAQPHLHLLVAEVDGQLAA
TCQLGVVATLTNGGRPFGMVEHVVTASAFRRRGISRQLLTHALALAWQQDCYKVMLLSGE
GREAAHRLYASIGFKAGIEKGFVLKQVDAMAAAGQAPNNQSVE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcatcagggcctgtactctgcaggacatggccggtctgctggcgctctatcgg
gaattgcgcccccatgaccctgcgcttgcgccggatgttgcccgcacggcgctgacggcc
ttgctggcgcagccccaccttcacctgctggtggcggaggtggatggccagctggcggcc
acctgtcagctcggcgtggtagcgaccctgaccaacggcggccggccgtttggcatggtg
gagcacgtggtgacggcctctgcgtttcggcgccggggcatcagccggcagttgctgacc
catgccctcgcgctcgcctggcagcaggattgctacaaggtgatgctgctctcgggggaa
gggcgcgaggcggcccaccggctctatgcgtcgatcggcttcaaggccggcatcgagaag
gggtttgtcctcaagcaggtcgacgccatggcggcggccgggcaggccccgaacaatcaa
tctgttgagtga

DBGET integrated database retrieval system