KEGG   Aeromonas hydrophila AL06-06: RY45_11595Help
Entry
RY45_11595        CDS       T03748                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00061  Fatty acid biosynthesis
ahh00780  Biotin metabolism
ahh01100  Metabolic pathways
ahh01212  Fatty acid metabolism
Module
ahh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RY45_11595
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RY45_11595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahh01004]
    RY45_11595
Enzymes [BR:ahh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     RY45_11595
Lipid biosynthesis proteins [BR:ahh01004]
 Fatty acid synthase
  Component type
   RY45_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJQ54691
LinkDB All DBs
Position
complement(2527837..2529078)
Genome map
AA seq 413 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNTAESSWQALLNGQSGISPIEHFDASEFATRFAGQVKDFDPE
QYGINRKEARKMDLFIQYGIAAGIQALDDAGLVINEANAERVGVAIGSGIGGLGLIEQNH
SSLVNGGPRKLSPFFVPSTIINMVSGHLSIMKGLQGPNIAVTTACTTGTHAIGMAGRMIA
YGDADVMVAGGAEKASTPMGMGGFAAAKALSNRNDEPTKASRPWDKDRDGFVLGDGAGVL
VLEEYEHAKARGAKIYAELVGFGMSGDAYHMTAPPADGNGGARAMQNAIKDAGIAPEQVG
YINAHGTSTPLGDVAELRGMKAVFGEHAKSLMISSTKSMTGHLLGAAGAIEAIITVLALR
DQMAPPTINLDNPDDECDLDLVPHVAKAGDFEYALSNSFGFGGTNGSLIFKRV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaacgcagagtcgtggtgaccggcttggggatgctttccccggtaggcaacact
gccgaatccagctggcaagccctgctcaacgggcagagcggcatttctcccatcgaacac
tttgatgccagcgagtttgcgacccgtttcgcaggccaggtcaaggatttcgatcccgag
cagtacggtatcaaccgcaaagaagctcgcaagatggacctcttcatccagtacggtatc
gccgcaggcatacaggcgctggatgatgccggtctcgtcatcaacgaggcaaatgccgag
cgcgtcggtgtggcgatcggttccggtatcggcggcctgggtctgattgaacagaaccac
agcagcctggtcaacggcggcccccgcaagctgagccccttcttcgtgccgtccaccatc
atcaatatggtgtccggtcatctctccatcatgaagggtctgcaagggccgaacatcgcc
gtgaccaccgcctgtaccacaggtacccatgccatcggcatggccggccggatgatcgcc
tacggtgatgcggacgtgatggtggccggcggcgccgagaaagcctccaccccgatgggg
atgggtggttttgcggcggccaaggcgctctccaaccgcaacgacgagcccaccaaggcc
agccgtccgtgggataaagatcgcgacggtttcgtgctgggtgatggcgccggggtgctg
gtgctggaagagtacgaacatgccaaggcccgcggtgccaagatctacgccgagctggtc
ggttttggcatgagtggcgatgcctaccacatgacggcgcctcccgctgacggcaacggt
ggcgcccgcgccatgcaaaatgccatcaaggatgccggcatcgctcccgagcaggtgggt
tacatcaacgcccacggcacgtccacccccctgggtgacgtggccgaactgcgcggcatg
aaagcggtgtttggcgagcatgccaaatccctgatgatcagctccaccaagtcgatgacc
ggtcacctgctgggtgccgccggcgccatcgaggcgatcatcacggtactggcgctgcgc
gatcagatggcgccgcccaccatcaacctggacaatccggatgatgagtgcgatctggac
ctggtgcctcatgttgccaaggctggcgacttcgaatatgccctctccaattccttcggt
tttggtggcaccaatggctcactgatcttcaaacgcgtataa

DBGET integrated database retrieval system