KEGG   Aeromonas hydrophila AL06-06: RY45_11605Help
Entry
RY45_11605        CDS       T03748                                 

Gene name
fabG
Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00061  Fatty acid biosynthesis
ahh00780  Biotin metabolism
ahh01100  Metabolic pathways
ahh01130  Biosynthesis of antibiotics
ahh01212  Fatty acid metabolism
Module
ahh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RY45_11605 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RY45_11605 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RY45_11605 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahh01004]
    RY45_11605 (fabG)
Enzymes [BR:ahh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     RY45_11605 (fabG)
Lipid biosynthesis proteins [BR:ahh01004]
 Fatty acid synthase
  Component type
   RY45_11605 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 DFP RmlD_sub_bind 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJQ54693
UniProt: A0A081UR40
LinkDB All DBs
Position
complement(2529555..2530289)
Genome map
AA seq 244 aa AA seqDB search
MSFTDKVVLVTGASRGIGRAIAETFAARGAKVVGTATSESGAEAISAYLGEQGCGMALNV
TSQESIEAVFAAIKARFGDIDILINNAGITRDNLLMRMKDDEWNEIIDTNLTSLYRLSKP
VLRAMMKKRNGRIISIGSVVGTMGNAGQVNYAAAKAGLVGFTKSLAREVASRGITVNAVA
PGFIETDMTKALNEEQRAGIMSQVPAARLGDPKEIAAAVVFLASDDAAYITGETLHVNGG
MYMV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaccgataaggttgtgttggtgaccggtgccagtcgtggtattggccgtgca
attgccgaaacttttgcggcccgtggcgccaaagtcgtcggcacggcgaccagcgagagc
ggtgccgaggcgatcagtgcctatctgggtgaacagggttgcggtatggcactgaacgtg
accagccaggaatccatcgaagccgtcttcgccgccatcaaggcacgttttggcgacatc
gacatcctgatcaacaacgccggtattacccgtgacaacctgctgatgcggatgaaggac
gatgagtggaacgagatcatcgacaccaacctcacttccctgtatcgactgagcaaaccg
gtgctgcgcgccatgatgaagaagcgcaatggccgcatcatcagcatcggctccgttgtg
ggcaccatgggcaacgccggtcaggtcaactatgcggccgccaaggcggggctggttggt
tttaccaagtcgctggcccgtgaagtggcctcccgtggcattaccgtgaacgcggttgcc
cccggtttcatcgagaccgatatgaccaaggcgctcaatgaagagcagcgtgccggcatc
atgagccaggtgcctgccgctcgtctgggcgatccaaaagaaattgccgctgctgtggta
ttcttggcatcggatgatgccgcctacatcactggcgaaaccctgcatgttaatggcggg
atgtacatggtgtaa

DBGET integrated database retrieval system