KEGG   Aeromonas hydrophila AL06-06: RY45_13530Help
Entry
RY45_13530        CDS       T03748                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00473  D-Alanine metabolism
ahh01100  Metabolic pathways
ahh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RY45_13530
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RY45_13530
Enzymes [BR:ahh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RY45_13530
Peptidoglycan biosynthesis and degradation proteins [BR:ahh01011]
 Precursor biosynthesis
  Racemase
   RY45_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJQ55046
UniProt: A0A0F6KE83
LinkDB All DBs
Structure
PDB: 

Position
2996551..2997777
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPKICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFTGRLMRV
RAATPAEVEQALPYKMEELIGSLVSAQGIADIAQRHHTNIPVHIALNSAGMSRNGIDLRL
ADSKEDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccacgctgatcctgggcctgctggccggtcaggccgtc
gcggccccttacctgccgctggccagcgatcatcgcaacggcgaagtgcagaccgccagc
aatgcctggctggaagtcgatctcggcgccttcgagcacaacatccagaccctcaaggat
cgcctcggtgacaaagggccgaagatctgcgccatcatgaaggccgacgcctacggccac
ggcatcgacctgctggtgccctcggtggtcaaggccggcatcccctgcatcggcatcgcc
agcaacgaagaggcccgcgtggcccgtgagaagggcttcaccggccgcctgatgcgggta
cgtgctgccaccccggccgaagtggaacaggccctgccctacaagatggaagagctcatc
ggcagcctggtgagtgctcagggcatcgccgacatcgcccagcgccaccacaccaatatc
ccggtgcacatcgcgctcaactccgccggcatgagccgcaacggcatcgatctgcgcctg
gctgactccaaggaagacgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatggggctggcccagttc
aaactggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggaagtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctgtacggtgactccatcccctcctacaccgagtacaagcgggtgatg
gcgttcaagacccaggttgcctccgtcaaccactacccggccggcaacaccgtcggttat
gaccgcaccttcaccctcaagcgcgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgggcgctgagcaacaaggcctatgtgctgatccagggccagaaggtg
ccggtggtgggcaagacctccatgaacaccatcatggtggacgtgaccgatctgaaaggg
gtcaaacccggtgacgaggtggtgctgttcggccgccagggtgaggctgaggtgaaacag
gcggatctggaagagtacaacggcgccctgctggcggacatgtacaccatctggggctac
accaaccccaagaagatcaagcgctaa

DBGET integrated database retrieval system