KEGG   Aeromonas hydrophila AL06-06: RY45_13565
Entry
RY45_13565        CDS       T03748                                 

Definition
(GenBank) hypothetical protein
Organism
ahh  Aeromonas hydrophila AL06-06
SSDB
Motif
Pfam: MarC LysE
Other DBs
NCBI-ProteinID: AJQ55053
UniProt: A0A0F6KE90
LinkDB
Position
complement(3005046..3005681)
AA seq 211 aa
MAAIDVSLYLKFFIGLFAIINPLGLLPVFVSLTSHQTPEERMKTNTTANIAVMIILLVSM
YMGQLILDGFGISLASFRIAGGSLITLIAWSMLQGKLGEVKHNKQEKGELAARESVAVVP
LALPLMAGPGAISSSIVYASQSTWSQMLGMSVVVMVFAFCSWLIFRAAPLLFKVMGNTGI
NVVTRIMGLIMMSLGIEIMVAGIKGVFPGLM
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcagcaattgacgtctctttatatctgaagtttttcatcggtttgttcgcgatcatc
aacccgctcggcctgttgccggtgtttgtcagcctgaccagccatcaaacgccggaagag
cggatgaagaccaacaccaccgccaacattgcggtgatgatcatcctgctggtctccatg
tacatggggcagctgatcctcgatggtttcggcatctcgctggcgtcgtttcgcattgcc
ggcggctcgctcatcaccctgatcgcctggtccatgctgcagggcaagctgggggaggtg
aagcacaacaagcaggagaaaggggagctcgccgcgcgggaatctgtcgctgtggtgccg
ctggcgctgccgctgatggccggccccggcgccatctcttcctctattgtctatgccagc
cagagcacctggtcccagatgctggggatgtcggtggtggtgatggtgtttgccttctgc
tcctggctcatcttccgcgccgcccccctgctgttcaaggtgatgggcaacaccggcatc
aacgtggtcacccggatcatgggtctcatcatgatgtcgcttggcatcgagatcatggtg
gcggggatcaagggggtcttccccggattgatgtga

DBGET integrated database retrieval system