KEGG   Aeromonas hydrophila AL06-06: RY45_13630Help
Entry
RY45_13630        CDS       T03748                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00220  Arginine biosynthesis
ahh00250  Alanine, aspartate and glutamate metabolism
ahh00290  Valine, leucine and isoleucine biosynthesis
ahh01100  Metabolic pathways
ahh01110  Biosynthesis of secondary metabolites
ahh01130  Biosynthesis of antibiotics
ahh01210  2-Oxocarboxylic acid metabolism
ahh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RY45_13630
   00290 Valine, leucine and isoleucine biosynthesis
    RY45_13630
   00220 Arginine biosynthesis
    RY45_13630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahh01007]
    RY45_13630
Enzymes [BR:ahh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RY45_13630
    2.6.1.66  valine---pyruvate transaminase
     RY45_13630
Amino acid related enzymes [BR:ahh01007]
 Aminotransferase (transaminase)
  Class I
   RY45_13630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJQ55065
UniProt: A0A081USC2
LinkDB All DBs
Position
3021404..3022618
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctatgacatccgcggcccg
gtgcataaagaagctcgccgtctcgaagacgaaggccaccgcatcatcaagctcaacatc
ggcaacccggccccgttcggttttgatgcgccggaagagatcatcaaggatgtgatcctc
aacatgccgctcagccagggctactgcgactccaaggggctgttctcggcccgcaaggcg
gtgatgcagtactaccagcagaaagggatgcgcaaggtcgacatcgacgacatctacatc
ggcaacggcgccagcgagctcatcgtgatggcgatgcaggcgctgctcaacaacggtgac
gagatgctggtgccctcccccgactatccgctgtggacggcggcagtgaccctctccggc
ggccatgcggtgcactatcgctgcgacgaaggggccgactggtatccggatctcgacgac
atccgcgcccgcatcaccccgcgcacccgcggcctggtgctgatcaaccccaacaacccg
accggcgccgtctacggcagcgagttcctgctggaagtgatcgagatcgcccgccagcac
aacctcatcatcttcgccgacgagatctacgacaagatcctctacgacgatatctcccac
accagcgtctgcaccctgtgcgacgatgtgatggtggtgaccttcaacggcctctccaaa
gcctaccgcgcctgtggcttccgtcagggctggatggtcattaccggtcccaagggccgt
gccaagggctacatcgaggggctggagatgctggcctccatgcggctctgtgccaacgtc
ccgatgcagcacgccatccagactgccctgggtggttaccagagcatcaacgagctgatc
ctgccgggcggccgcctgcgccgccagcgcgacaaggcgtgggagctgctcaacgatatt
cctggggtatcctgcgtcaaacccaagggggcgctctacatgttcccgcgcctcgacccc
aaggtgtacgacatccgcgacgaccagaagatggtgttcgatctgctgcagcaggaaaaa
ttgctgctggtgcagggcaccggcttcaactggccggcgccggatcacttccggctggtg
ttcctgccccgggaagaggagctggaagaggctatcggccgtctcgcccgcttcctcaag
ggctacaagcagtaa

DBGET integrated database retrieval system