KEGG   Aeromonas hydrophila AL06-06: RY45_21765
Entry
RY45_21765        CDS       T03748                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RY45_21765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ahh01001]
    RY45_21765
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ahh02022]
    RY45_21765
Enzymes [BR:ahh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RY45_21765
Protein kinases [BR:ahh01001]
 Histidine kinases
  OmpR family
   RY45_21765
Two-component system [BR:ahh02022]
 OmpR family
  RstB-RstA
   RY45_21765
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 SKA2 HATPase_c_5
Other DBs
NCBI-ProteinID: AJQ56555
LinkDB
Position
4780013..4781338
AA seq 441 aa
MRRLFIQFYLLLIGCFTLAILLVGMVYQVTAERAGDRYLERMMQGSLGLLTGELARLPPE
HWPARMAEQSRQLTLPLQIGALANQPLANEDQAFLEAGNIVIVEEDDTFLQRIPGTDQVL
IVGPVPYLSYLHELHWVDVGLLLVIGLSLGLPILLWLRPHWRGLQQLEQTARRVGDGDLS
CRTRLPPGSSLGRVGRTFDQMTEQLQAMLASRKQLTDAIAHELRTPLVRLRYRLAMLDPA
PSAEEQQGLERDLGALDALIEEMLTYARLDRPELPLQCSELELGSWAGSRLADWQALRPD
KRLDFVRPAMALPWRGDTRLLDRALENLIGNALRHAASRVTLSMACQQDHYLLEVADDGV
GIDPALAPQIFEPFVRLDQSRDRRTGGAGLGLAIVRSIARHHGGEVQLLPSSSGARFCLM
LPVHLDTNRHQSLTEPQVEQP
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgcgccgcctgtttatccagttctatctgctgctgatcggctgtttcaccctggccatc
ctgctggtcggcatggtctatcaggtcaccgccgagcgggcgggagatcgctatctggag
cggatgatgcagggctccctcggcctgctcaccggcgagctggcccgcttgccgccggaa
cactggcccgcccgcatggcggagcagagccgacagctcaccctgccgctgcagatcggc
gccctcgccaaccagccgctggccaacgaggatcaggccttcctggaggccggcaacatc
gtcatcgtcgaggaggatgacaccttcctgcagcgtattccgggcaccgatcaggtgctg
atcgtcggccccgtgccctatctctcctacctgcacgagctgcactgggtcgacgtgggg
ctgctgctggtcataggtctctcgctggggctgccgatcctgctctggctacgcccgcac
tggcgcggcctgcaacagctcgaacagaccgcccgccgggtcggcgacggcgatctctcc
tgccgcacccgtttgccacccggcagcagcctgggccgggtcggccgcaccttcgaccag
atgaccgagcagctgcaggccatgctggccagccgcaagcagctgaccgacgccatcgcc
cacgagctgcgcaccccgctggtgcggcttcgctaccggctcgccatgctggatccggcg
ccctcggccgaggagcagcaggggctggagcgggatctaggcgcgctggacgccctcatc
gaggagatgctcacctacgccaggctcgatcgccccgagctgccgctgcagtgcagcgag
ctggagctcggcagctgggctggcagccgcctcgccgactggcaggcgctgcggccggac
aaacggctcgacttcgtgcgcccggccatggccctgccctggcgcggcgatactcgcctg
ctggatcgggcgctggagaacctcatcggcaacgccctgcgccacgccgctagccgagtg
accctcagcatggcgtgccagcaggatcactatctgctggaggtggccgacgacggcgtc
ggtatcgatccggcgctggcgccgcagatcttcgagcccttcgtgcggctggatcagagc
cgcgaccgacgcaccggcggcgccgggctggggctggccatcgtacgcagcatcgcccgc
caccacggcggcgaagtgcagctgctgccgagcagcagcggtgcccgtttctgtctgatg
ctgcctgtacatttggatacaaaccgtcaccagtcactcactgaaccgcaggtcgaacag
ccctag

DBGET integrated database retrieval system