KEGG   Aeromonas hydrophila AL06-06: RY45_21985Help
Entry
RY45_21985        CDS       T03748                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00260  Glycine, serine and threonine metabolism
ahh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RY45_21985 (tdh)
Enzymes [BR:ahh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     RY45_21985 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 FAD_binding_2 Pyr_redox_2 MTS Methyltransf_25 FAD_oxidored 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJQ56596
UniProt: A0A347A0H8
LinkDB All DBs
Position
4828879..4829907
Genome map
AA seq 342 aa AA seqDB search
MKALSKLHKEVGIWMTDVPAPELGHNDLLIKIRKTAICGTDIHIYNWDEWSQKTIPVPMV
VGHEYVGEVVAIGQEVRGFAVGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGA
FAEYLVIPAFNAFKLPDNVPDELAAIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAKEQLSDVMSELGMTEGFDVGLEMS
GVPSAFQDMIDKMNHGGKIAMLGIPPATMAIDWGKVIFKGLFIKGIYGREMFETWYKMAS
LIQSGLDLSPIITHRFHIDDFQQGFDAMRSGQSGKVILSWDK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctctccaaactgcacaaagaagtcggcatctggatgacggacgtaccggcc
cccgaactcggccacaacgacctgctgatcaagatccgcaagaccgccatctgtggcacc
gacatccatatctacaactgggacgaatggtcacagaagaccatcccggtgcccatggtg
gtcggccacgaatacgtcggggaagtggtcgccatcggccaggaagtgcgcggcttcgcc
gtgggggatcgcgtctctggtgaaggccatatcacctgcggccactgccgcaactgtcgc
gccggccgcacccacctgtgccgcaacaccataggcgtcggcgtcaaccgccccggcgcc
ttcgccgagtatctggtgatcccggccttcaacgccttcaagctgccggacaacgtcccc
gatgaactggccgccatcttcgatccgttcggcaacgcggtgcacaccgccctctccttc
gatctggtcggtgaagacgtgctgatcaccggcgccggccccatcggcatcatggccgcc
gccgtctgccgccacgtgggagcccgccacgtggtgatcaccgacgtcaacgaataccgg
ctcgagctggcccgcaagatgggtgccactcgcgccgtcaacgtggccaaggaacagctc
agcgacgtgatgagcgagctcggcatgaccgaagggttcgacgtggggctggagatgtcc
ggcgtgcccagcgccttccaggacatgatcgacaagatgaaccacggcggcaaaatcgcc
atgctcggcatcccccccgccaccatggccatcgactggggcaaggtgatcttcaaggga
ctgtttatcaaagggatctacggtcgtgaaatgttcgagacctggtacaagatggccagc
ctgatccagtccgggctggatctctcccccattattacccaccgcttccacatcgacgac
ttccagcaagggttcgatgccatgcgctcaggccagtccggcaaggtgatcctcagctgg
gacaaataa

DBGET integrated database retrieval system