KEGG   Aeromonas hydrophila AH10: VU14_00635Help
Entry
VU14_00635        CDS       T03886                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00260  Glycine, serine and threonine metabolism
ahi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VU14_00635 (tdh)
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     VU14_00635 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 FAD_binding_2 Pyr_redox_2 MTS Methyltransf_25 FAD_oxidored 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AKA15487
UniProt: A0A347A0H8
LinkDB All DBs
Position
complement(144047..145075)
Genome map
AA seq 342 aa AA seqDB search
MKALSKLHKEVGIWMTDVPAPELGHNDLLIKIRKTAICGTDIHIYNWDEWSQKTIPVPMV
VGHEYVGEVVAIGQEVRGFAVGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGA
FAEYLVIPAFNAFKLPDNVPDELAAIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAKEQLSDVMSELGMTEGFDVGLEMS
GVPSAFQDMIDKMNHGGKIAMLGIPPATMAIDWGKVIFKGLFIKGIYGREMFETWYKMAS
LIQSGLDLSPIITHRFHIDDFQQGFDAMRSGQSGKVILSWDK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctctccaaactgcacaaagaagtcggcatctggatgacggacgtaccggcc
cccgagctcggccacaacgacctgctgatcaagatccgcaagaccgccatctgtggcacc
gacatccatatctacaactgggacgagtggtcacagaagaccatcccggtgcccatggtg
gtcggccacgaatacgtcggggaagtggtcgccatcggccaggaagtgcgcggcttcgcg
gtcggagaccgggtatccggtgaaggccacatcacctgtggccactgccgcaactgccgt
gccggccgcacccacctgtgccgcaacaccataggcgtcggcgtcaaccgccccggcgcc
ttcgccgagtatctggtgatcccggccttcaacgccttcaagctgccggacaacgtcccc
gatgaactggccgccatcttcgatccgttcggcaacgcggtgcacaccgccctctccttc
gacctggtcggtgaagacgtgctcatcaccggcgcaggccccatcggcatcatggccgca
gccgtctgccgccacgtgggggcccgccacgtggtgatcaccgacgtcaacgaataccgg
ctcgagctggcccgcaagatgggcgccactcgcgccgtcaacgtggccaaggaacagctc
agcgacgtgatgagtgaactcggcatgaccgaagggttcgacgtggggctggagatgtcc
ggcgtgcccagcgccttccaggacatgatcgacaagatgaaccacggcggcaaaatcgcc
atgctcggcatcccccccgctaccatggccatcgactggggcaaggtgatcttcaaagga
ctgtttatcaaagggatctacggtcgtgaaatgttcgagacctggtacaagatggccagc
ctgatccagtccggactggatctctcccccatcatcacccaccgcttccacatcgacgac
ttccagcaagggttcgatgccatgcgctcaggccagtccggcaaggtgatcctcagctgg
gacaaataa

DBGET integrated database retrieval system