KEGG   Aeromonas hydrophila AH10: VU14_02765
Entry
VU14_02765        CDS       T03886                                 

Definition
(GenBank) adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    VU14_02765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahi03400]
    VU14_02765
Enzymes [BR:ahi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     VU14_02765
DNA repair and recombination proteins [BR:ahi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VU14_02765
 Prokaryotic type
     VU14_02765
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S Whib HHH_5 HHH_8
Other DBs
NCBI-ProteinID: AKA15868
LinkDB
Position
complement(609972..611033)
AA seq 353 aa
MNNSDNATFATRILDWYQLHGRKTLPWQQEKTPYRVWVSEIMLQQTQVATVIPYYQRFMA
RFPDVLALADAPIDEVLHHWTGLGYYARARNLHKAAQQIRDLHGGLFPEQLEEVMALPGI
GRSTAGAVLSLSLGQPHAILDGNVKRVLTRWLALPGWPGQKQVENDLWELATRLTPKLGV
AHYNQAMMDMGATVCTRSKPACERCPVREDCQGLSQGNPTAYPNSKPKKSIPARTGIMLL
IRHGDQLLLEKRPPQGIWGGLYCFPQVESDAEVAGLLQRLGLTGSEPRELAGFRHTFSHF
HLDIRPMLVETDAPPAPLLMEADNRLWYNLRHPAEVGLAAATARLLAYPDLQP
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgaacaactcagataacgcgaccttcgccaccaggatcctggactggtatcagctccac
ggccgcaagaccctgccctggcaacaggagaagaccccctaccgggtatgggtctcggaa
atcatgctgcagcagactcaggtcgctacggtcattccctactatcagcgctttatggcc
cgctttcccgacgtgctggcactggccgacgcccccatcgacgaggtgctgcaccactgg
accgggctcggctattacgctcgcgcccgcaacctgcacaaggcggcccagcagatccgc
gacctccatggcggcctcttcccggagcagctggaggaggtgatggcgttgccggggatc
ggccgctccaccgcgggcgccgtgctctccctctcccttggccagccccacgccattctg
gatggcaacgtgaagcgggtactcacccgctggctggccctgcccggctggcccggccag
aagcaggtggagaacgatctgtgggagctggccacccgcctcacccccaagctcggggtg
gcccactacaaccaggccatgatggacatgggcgccaccgtctgcacccgcagcaagccc
gcttgcgaacgctgcccggtgcgggaggattgccaggggctgtcgcagggcaaccccacc
gcctaccccaacagcaagcccaagaagagcatcccggcccgcaccggcatcatgctgctc
atccgccacggcgatcagctgctgctggagaagcggccgccgcaagggatctggggcggg
ctctactgcttcccccaggtggagtcggacgccgaggtggcagggctgttgcagcggctc
ggcctgaccggcagcgaaccccgtgaactggccggttttcgccatactttcagccacttt
cacctcgatatccggcccatgctggtcgaaaccgacgcaccgccggcacccctgctcatg
gaagcggataaccgactctggtataacttacgccatcctgcagaggtgggtctggcggcc
gccacggcccgtctgctcgcctatccggacttacaaccatag

DBGET integrated database retrieval system