KEGG   Aeromonas hydrophila AH10: VU14_04040Help
Entry
VU14_04040        CDS       T03886                                 

Definition
(GenBank) peptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VU14_04040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ahi01003]
    VU14_04040
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
    VU14_04040
Enzymes [BR:ahi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VU14_04040
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VU14_04040
Glycosyltransferases [BR:ahi01003]
 Polysaccharide
  Bacterial polysaccharide
   VU14_04040
Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VU14_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AKA16095
LinkDB All DBs
Position
853671..855992
Genome map
AA seq 773 aa AA seqDB search
MATQRRKRTPKKAAPKRTIWRTLFWLGFKLSLVGAAFMVVFGIYLDTKVRERFDGEKWQL
PVMVYSRPLELYPSQRLSQAQMLRELNMLSYKQVRQPHTPGEYAVSGNRIELIRRPFEFH
DGADAARGLRLTFNGARLEGIQSLENQRQLGYAQMDPVLLDRLNTEDREDRLLVRIAEVP
DSLLITLLTTEDRDFYQHGGVSPVAIMRAMAANLLAGRTVQGGSTLTQQLAKNFFLTRER
SLWRKAQEAYMAVLIDYRYSKDEILEAYLNEVYLGQNFSQGVYGFGLASYFYFGIPVNEL
DIDQVALLVGMVKGPSYYDPWRFPERAKARRDLVLKLLMDHGSLQPAEYELASKQPLGII
TRGQMSYGRTPAFMGLLKREIQSRFGPDLLKQSGLKIFTSLDPIAQHAAEQAVESGLAQI
EKLRGKKKLEAAMVVSDWHKGEVVAMVGGRDPRYAGFNRALDARRQIGSLVKPAVYLTGL
SNGLTLGTPLKDQPIRIRGKDGQIWTPQNYDRKFRQSVPLIDALASSLNVPTVNLGLQVG
LDKVVDTLHKLGVEQEIQPYPSLVLGAVALSPMEVNQMYLPIANQGLTQPLSAIRAVVNS
DGSKLYQHDEAAKRVTDEQASWLTLFAMTKTVSQGTARALGAKFPGATMAAKTGTTNELR
DSWFTGLDNNELVSIWVGRDDNTPAGLTGASGALQLFSGYMSQRGVNSLAMNMPQGVSWA
SFSRASGTRVTSDCPGSLQVPAKLAGLAEPMGCASPVSSPANALDNWFNGFFN
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcaacgacgcaagcgcacccccaagaaggcggcgcccaaacgcaccatctgg
cgcacgctgttctggctgggcttcaagctctccctggtgggagcggccttcatggtggtg
tttggcatctacctcgataccaaggtgcgtgaacgcttcgacggcgagaagtggcagttg
ccggtgatggtctacagccggccgttggaactctatcccagccagcgcctctcccaggcc
cagatgctgcgcgagctcaacatgctgagctacaagcaggtgcgccagccccataccccg
ggcgagtatgcagtgagcggcaaccgcatcgagcttatccgccggccattcgaattccat
gacggggccgatgccgcccgcggcctgcgcctcactttcaacggtgcgcggctggagggg
atccagtcgctggagaaccagcgtcagctcggttacgcccagatggacccggtgctgctc
gatcgcctcaacaccgaggatcgggaggatcgcctgctggtgcgcatcgccgaggtgccg
gacagcctgctgatcaccctgctcaccaccgaggatcgcgacttctaccagcacggcggc
gtctcgccggtggccatcatgcgcgccatggcggccaacctgctggcgggtcgcaccgtg
caggggggcagtaccctgacccagcagctggccaaaaacttcttcctgacccgggaacgc
agcctgtggcgcaaggcgcaggaagcctacatggcggtgctgatcgactatcgctacagc
aaggacgagatcctggaggcctatctcaacgaggtctatctggggcagaacttctcccag
ggggtttatggcttcgggctcgcctcctacttctacttcggcattccggtcaacgagctg
gacatcgatcaggtggccctgctggtgggcatggtgaaggggccctcctattacgatccc
tggcgcttcccggagcgggccaaggcgcgtcgtgatctggtgctcaagctgctgatggat
cacggcagcctgcaaccggccgagtatgagctcgccagcaagcagccgctcggcatcatt
acccgcggccagatgagctatggccgtaccccggccttcatgggcctgctcaagcgggag
atccagagccgcttcggcccggatctgctcaagcagtccggcctcaagattttcaccagt
ctggatcccatcgcccagcacgccgccgagcaggcggtagagtcgggtctggcccagatc
gagaagctgcgcggcaagaagaagctggaggcggccatggtggtctccgactggcacaag
ggcgaggtggtggccatggtgggcggccgggatccgcgctacgccggcttcaaccgggcg
ctggatgcccgtcgccagataggctcgctggtcaagcccgcggtctacctgaccggcctc
tccaacggattgaccctgggcacgccgctcaaggaccagccgatccgcattcgcggcaag
gatggccagatctggaccccgcaaaactacgaccgcaagttccgtcagagcgtgccgctg
atagatgcgctggccagctccctcaacgtgccgactgtcaatctggggctgcaggtgggg
ctggacaaggtggtagacaccctgcacaagctgggggtggagcaggagatccagccctat
ccgtcgctggtgctgggggcggtggcgctctcgccgatggaggtgaaccagatgtacctg
cccatcgccaaccaggggctgacccagccgctgtcggcgatccgggcggtggtcaacagc
gacggcagcaagctctatcagcatgatgaagcggccaagcgggtgaccgacgaacaggcc
agctggctgaccctgttcgccatgaccaagacggtgagccagggcacggcgcgcgcgctc
ggtgccaagttccccggcgccaccatggcggccaagacgggcaccaccaacgagctgcgc
gactcctggttcaccgggctcgacaacaacgagctggtcagtatctgggtcggtcgcgat
gacaacaccccggccggcctgaccggtgccagcggtgccctacagctgttcagcggctac
atgagtcagcgcggggtcaacagcctggccatgaacatgccgcaaggggtgagctgggcc
agcttctcccgcgccagcggcacccgggtcaccagcgactgcccgggcagtctgcaggtg
ccggccaagctggccgggctggctgagcccatgggctgcgccagcccggtgtccagcccg
gccaatgcgctggacaactggttcaacggtttcttcaactga

DBGET integrated database retrieval system