KEGG   Aeromonas hydrophila AH10: VU14_05365Help
Entry
VU14_05365        CDS       T03886                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00550  Peptidoglycan biosynthesis
ahi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VU14_05365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ahi01002]
    VU14_05365
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
    VU14_05365
Enzymes [BR:ahi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VU14_05365
Peptidases [BR:ahi01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   VU14_05365
Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VU14_05365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AKA16327
UniProt: A0A2N0U7E6
LinkDB All DBs
Position
complement(1139089..1140279)
Genome map
AA seq 396 aa AA seqDB search
MSKFARSVILASLISATAQANTPVPTPNANPVVVPAAPEISAKAHILIDYYSGQVLAEQN
AEERLPPASLTKMMTSYIIGQELLKGNIKRTDMVTISQNAWSKNYSDSSKMFIEVGKQVS
VDDLNKGIIIQSGNDACVAMAEFLAGSTDSFASLMNSWAAKLGMNDSHFMNPHGLDAEGH
YSTAHDMARLGQALIRDLPDEYKIYAQKSFVFNGITQHNRNRLLWDQSLQVDGIKTGHVS
QVGYNLVSSATNNEGMRLIAVVLGASSEASRAAESKKLLTYGFRFFQSLTPYKAGTELVT
QKIWMGDKSEVKLGVDKDVSVLVTRGQGNNLKADFQLESELKAPLAKGQRVGTVFLKQGD
KEIKQVPLVALEEVQEGGLMSRLWDYLVMLVSSWFK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatttgcccgttcagttattctggcctccctgataagcgccaccgctcaggcc
aacacgcctgtaccgaccccgaacgccaaccccgtggtcgttcccgccgcgccggagatc
tccgccaaggcccatattctgatcgactactactcgggtcaggtgctggccgagcagaac
gccgaagagcgtctgccgcccgccagtctgaccaagatgatgacctcctacatcatcggc
caggagctgctgaaggggaacatcaagcgcaccgacatggtgaccatcagccagaacgcc
tggtccaaaaactactccgactcctccaagatgttcatcgaggtgggcaagcaggtctcg
gtcgatgatctcaacaagggcatcatcatccagtccggcaacgacgcctgcgtcgccatg
gccgaattcctggccggcagcaccgactccttcgccagcctgatgaacagctgggccgcc
aagctcggcatgaacgacagccacttcatgaacccgcacggactggatgcagaaggtcac
tacagtaccgcccacgacatggcgcgcctgggccaggccctgatccgcgacctgccggac
gagtacaagatctacgcccagaagtccttcgtgttcaacggcatcacccagcacaaccgc
aaccgtctgctgtgggatcaatccctgcaagttgacggcatcaagaccggccacgtcagc
caggtcggctacaacctggtctcctccgccaccaacaacgaaggcatgcgcctgatcgcc
gtggtgctgggcgccagcagcgaagcctcccgcgccgccgagagcaagaaactgctcacc
tacggtttccgtttcttccagagcctgaccccctacaaggccggcaccgagctggtgacc
cagaagatctggatgggcgacaagtctgaagtgaaactgggcgtcgacaaggacgtctcc
gtgctggtcacccgtggccagggcaacaacctcaaagccgacttccagctcgaaagcgag
ctgaaagcaccgctggccaagggccaacgggtcggtaccgtgttcctcaagcaaggcgac
aaggagatcaagcaggttccgctggtcgccctggaagaggtgcaggaaggtggcctgatg
agccgtctgtgggattacctggtgatgctggtctccagctggttcaagtaa

DBGET integrated database retrieval system