KEGG   Aeromonas hydrophila AH10: VU14_05680Help
Entry
VU14_05680        CDS       T03886                                 

Definition
(GenBank) penicillin-sensitive transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00550  Peptidoglycan biosynthesis
ahi01100  Metabolic pathways
ahi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VU14_05680
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VU14_05680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ahi01003]
    VU14_05680
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
    VU14_05680
Enzymes [BR:ahi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VU14_05680
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VU14_05680
Glycosyltransferases [BR:ahi01003]
 Polysaccharide
  Bacterial polysaccharide
   VU14_05680
Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VU14_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AKA16389
LinkDB All DBs
Position
complement(1205045..1207534)
Genome map
AA seq 829 aa AA seqDB search
MLKWLVRLFIVMMLGAVLGVASLIGIYFYIKPQLPDVTALRDVKLATPMKVYSRDGELIS
QFGEIRRIPLHLDEIPQSMIDAVLATEDARFYEHPGIDPIGIIRAATVWAVSGQARQGAS
TITQQVARNFFLSNEKTLVRKIKEVFLAWRIEQNLSKDEILQLYLNKIPLGYRAFGVGAA
AQVYFGKEVKDLTLDEIAIIAGLPKAPSMLNPIRSPERAFARRNVVLGRMLETGKITQAQ
FDEASKMPVKARYHGAEITLNAPYLGEMVRQKMVEQFGEDAYTMGLHVYTTVTAKRQRAA
RLALLDGVFDYDTRHGYKGVTAQLWKAGEADWDYDKIMAHLAKQPTYEPLMAAVVTKLAD
KSATIVLKNGKQAELGWNGIKWARAFITDDRQGFAPRSARDMLKVGAQIWVREKGEELLL
SQIPEVNAALVAMNPQDGAIEALVGGFSFELSKFNRVDQARRQIGSNIKPFLYATALEQG
YTLASLINDAPINQWDPSKGPMWQPKNSPAIYEGPTSLRLGLAKSKNVMSVRLMRAIGLD
TYIDGLTRFGFARDTISPNESLALGAAEFTPLEVVRGYSVMANGGFQVTPYFITEVTDSF
GAPLYQANPAAACRDCGVLAAAGLDSADAYANTAPDWKAQCPIDPVVPGNMAPQTISAQS
TFLVTDTLTTAIWGGNGWRGTGWRAARDLKRHDISGKTGTTNESRDAWFSGYTPNLVATS
WIGFDNHQRGLGRAEFGGGAAQPIWIDFMKTALKQVPERKMPVPEGIITVRIDRETGLLT
NRTDGSSTEEFFKEGTEPTRYATQSSDGNQVYGGEGSPTDGPVSTDDIF
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaatggctcgtacgcctgtttattgtcatgatgctgggtgctgtgctgggtgtt
gccagcctcatcggtatctacttctacatcaagccccagttgccggatgtgaccgcgctg
cgcgacgtcaagctggccaccccgatgaaggtgtacagccgggatggggaattgatctcc
caatttggcgaaattcgtcgcatcccgctgcatctggatgaaatcccccagtcgatgatc
gatgcggtactggcgaccgaagatgcccgtttctatgagcacccggggatcgaccccatc
ggcatcattcgtgcagccaccgtctgggccgtctccggtcaggcccgccagggcgccagt
accattactcagcaggtcgcccgcaacttcttcctgagcaatgaaaagacgctggtgcgc
aagataaaagaggtcttcctggcctggcgcatcgagcagaatctctccaaggacgagatc
ctgcagctctatctcaacaagatcccgctcggctaccgggcattcggggtcggtgccgcc
gcccaggtttactttggcaaggaggtcaaggacctgacgctggacgagatcgccatcatt
gccggcctgcccaaggcaccatccatgctgaaccctatccgctcgccggaacgtgccttt
gcccgtcgcaacgtggtacttggccgcatgctggaaaccggcaagatcacccaggcccag
tttgacgaagcgtccaagatgccggtcaaggcccgctatcacggtgccgagatcaccttg
aatgccccttatctgggggagatggtgcgccagaagatggtggagcaatttggtgaagat
gcctacaccatgggcctgcacgtctacaccacagtcaccgccaagcgccagcgcgccgcc
cggctggccttgctcgacggcgtgttcgactatgacacccgccatggctacaagggcgtg
accgcccagctgtggaaagcgggcgaagccgattgggattatgacaagatcatggcccat
ctggccaagcagcccacctatgagccgctgatggccgccgtcgtcaccaagctggctgac
aagagtgcgaccatagtgctgaagaacggcaaacaggctgagctcggctggaacggcatc
aagtgggcacgcgccttcatcaccgacgatcgtcagggctttgcgccccgctcggcccgc
gacatgctgaaagtgggcgcccagatctgggttcgggaaaagggtgaagagctgctgctc
tcccagatccccgaggtcaacgccgctctggtggccatgaacccgcaggatggagccatc
gaggcgctggtcggcggcttcagcttcgagctctccaagttcaaccgggtcgatcaggca
cgccgccagataggctccaacatcaagcccttcctctatgccaccgcgctggaacagggc
tacaccctggcctctctcatcaacgatgcgccgatcaaccagtgggatccctccaagggc
cccatgtggcagcccaaaaactccccggccatctatgaaggccccacttccctgcgcctc
ggacttgccaagtcgaagaacgtgatgtcggtacgcctgatgcgcgccatcgggctggat
acctacatcgacggtctgacccgcttcggctttgctcgcgataccatctcgcccaacgaa
tcgctggccctgggtgctgccgagttcactccgctggaagtggtgcgcggctactcggtc
atggccaacggcggcttccaggtcaccccctacttcatcaccgaagtcaccgacagcttc
ggcgcgcctctctatcaggccaacccggcagccgcctgccgtgactgtggcgtgctggcc
gccgccggtctcgacagtgcggatgcctatgccaatacggcgccggactggaaagcccag
tgccccatcgatccggtcgttcccggcaacatggcaccgcagaccatcagtgcccagagc
accttcctggtgaccgacaccctgaccaccgccatctggggtggcaatggctggcgcggt
accggctggcgggcggcgcgcgacctcaagcgccacgatatctccggcaagaccgggacc
accaacgaatcccgtgatgcctggttctccggctataccccgaatctggtcgccacctcc
tggatcggttttgacaaccaccagcgtggtctgggccgggccgaatttggcggcggtgcc
gcacagcccatctggatcgacttcatgaagacggcgctcaagcaggtgcctgagcgcaag
atgccggtaccggaagggatcatcacggtgcggatcgatcgtgagaccggcctgctgacc
aaccggaccgacggcagcagcacggaagagttcttcaaggaaggcaccgagccgacccgc
tacgcgacacagagctcggatggcaatcaggtgtacggcggtgagggttcgcccaccgat
ggtcccgtttccaccgacgatatcttctaa

DBGET integrated database retrieval system