KEGG   Aeromonas hydrophila AH10: VU14_05710Help
Entry
VU14_05710        CDS       T03886                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ahi01100  Metabolic pathways
ahi01110  Biosynthesis of secondary metabolites
ahi01130  Biosynthesis of antibiotics
ahi01230  Biosynthesis of amino acids
Module
ahi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VU14_05710 (aroK)
Enzymes [BR:ahi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VU14_05710 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA_22 ABC_tran Thymidylate_kin AAA_24 AAA_28 AAA TsaE Ploopntkinase3 AAA_5 APS_kinase AAA_29 AAA_17 Guanylate_kin AAA_7 RsgA_GTPase AAA_PrkA RNA_helicase AAA_25 IstB_IS21 GTP_EFTU DUF2385
Motif
Other DBs
NCBI-ProteinID: AKA16395
UniProt: A0A081UN00
LinkDB All DBs
Position
1212988..1213506
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRHLAEQLHMEFFDSDHEIERRSGADIGWVFDVEGEEGFR
IREEKVIGDLSEQQGIVLATGGGAIKSRETRNKLSARGIVVYLETTIEKQLARTQRDKRR
PLLQTEEPPREVLERLAQERNALYEEVADFVIQTDDQSAKVVANQIVKLIGM
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttcctgataggtcccatgggtgcgggcaagagcaccata
ggtagacatctggcagaacaactgcatatggagtttttcgactcagatcatgagattgag
cgccgcagtggtgccgatatcggctgggtgttcgatgttgaaggcgaagagggtttccgg
attcgcgaagagaaggtcatcggtgacctttccgaacagcagggtatcgtgctggcgacg
ggtggcggtgccatcaagagccgtgaaacacgcaacaaactctctgctcgcggtatcgtg
gtgtacctcgaaaccaccattgagaagcaactggcacgtacgcaaagagacaagcgtcgc
cccttgctgcaaaccgaagagccgccgcgcgaagtactcgagcgtctggcacaagaacgc
aacgccctgtatgaagaagtggctgactttgtcatccagactgatgaccagagcgctaaa
gttgttgctaatcaaatcgttaagttgatcggcatgtaa

DBGET integrated database retrieval system