KEGG   Aeromonas hydrophila AH10: VU14_06705Help
Entry
VU14_06705        CDS       T03886                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ahi01100  Metabolic pathways
ahi01110  Biosynthesis of secondary metabolites
ahi01130  Biosynthesis of antibiotics
ahi01230  Biosynthesis of amino acids
ahi02024  Quorum sensing
Module
ahi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VU14_06705
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VU14_06705
Enzymes [BR:ahi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     VU14_06705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AKA16574
LinkDB All DBs
Position
complement(1439469..1440575)
Genome map
AA seq 368 aa AA seqDB search
MAVLNSVMRAFAVEALPTPADLLALHPCPADLATGIDQHRQQVRQILSGEDDRLLVVIGP
CSIHDPLAALDYARRLAVLAHDYRDRLQIVMRTYFEKPRTTVGWKGLVFDPHLDGSNDIG
HGLQLARQLLLDINQLGLATATEFLDTTSFLYLADLISWGAIGARTTESQVHRQLASALP
CPIGFKNGTDGNIRVAIDAIQASEASHLFTAPGSQGGMVVIKSEGNPAGHIILRGGTRPN
YHQSDVEEAAERLARQGLTPRLMVDCSHGNSQKLHKNQIRVAGELCRQLGEGSDAIAAVM
VESFLQGGSQKPAPLAELVYGQSVTDACLCWDDTQTLLAMLAEAVETRRQHPGRAQPDIA
RWHAQLAS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcttgaactcggtaatgcgcgccttcgcggtggaggctctccccactcctgcc
gacctgttggcacttcacccctgtcccgccgacctggcaaccgggatcgatcagcaccgt
cagcaggttcgccagatcctgagcggggaagatgatcgcctgctggtggtcatcggtccc
tgctccattcacgatcccctcgccgccctcgattacgcccggcggctggcagtgctggcc
cacgactatcgggatcggctgcagatagtgatgcgcacctatttcgagaagccccgcacc
acggtgggctggaaggggctggtgttcgatccccatctggacggcagcaacgacataggt
catggcctgcagctggcacgccagctgctgctcgacatcaaccagctggggctggccacc
gccaccgagtttctcgataccaccagcttcctctacctggccgatctcatcagctgggga
gcgatcggcgcccggaccacggagtcacaggtgcaccggcagctggcctcagccctgccc
tgccccatcggcttcaagaacggtacggatggcaacatccgggtggccatcgatgccatc
caggccagtgaagcgtcccacctgtttaccgctcccggcagccagggcggcatggtggtg
atcaagagtgagggcaacccggccggccacatcatcttgcgcggcggtacccgtcccaat
tatcaccagagcgatgtggaagaggcggccgagcgcctggcacggcaggggctcacgccc
cgactgatggtggattgcagccacggcaacagccagaaactgcacaagaaccagatccgg
gtggcaggagagctctgccgccagctgggggaaggcagcgacgccatcgccgccgtcatg
gtcgagagcttcctgcaggggggcagccagaaaccggcgccgctggccgagctggtgtat
ggccagtcggtcaccgacgcctgcctgtgctgggacgatacccagaccctgctcgccatg
ctggcagaggccgtcgagacacggcgccagcaccctggtcgggcacaaccggacatcgcc
cgctggcatgcccagctggccagttga

DBGET integrated database retrieval system