KEGG   Aeromonas hydrophila AH10: VU14_07300
Entry
VU14_07300        CDS       T03886                                 

Definition
(GenBank) aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    VU14_07300
Enzymes [BR:ahi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     VU14_07300
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: AKA16679
LinkDB
Position
1573651..1574757
AA seq 368 aa
MKKNIPVTQPFLPELKEFIPYLEKIWDNRWLTNNGPFHQELEVRLAEYLGVEHVSLFNNA
TIALITALQAMRINGEVITTPYSFVATSHSIMWNGLEPVFVDIDPTTFNIDPEKIEAAIT
PRTTAIMPVHCYSNPCDVEAIQKIADNYGLKVIYDAAHAFGIKYKGQSILNWGDLSILSF
HATKVFNTFEGGAIISPDAKTKQRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQL
KHIDQAMQSRQIIDERYRTALRDVPGITMYKHNPYANSNFSYFPILVDNDYKLSRDELYE
KLKDNNILSRRYFYPLISNMPMYRGLVSSNAKNLEHANVVSDKVLCLPIFDTLKLEDQLN
IIKLINEA
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaaaaaaaacattcctgtcacacagccatttttgcctgaattaaaagagtttatcccg
taccttgagaaaatatgggataatagatggttaacaaataatgggccttttcatcaagag
cttgaggtcagactagcagaatatttaggggtagagcatgtatcactatttaataatgct
acaattgcactaattacagcattgcaagcaatgcgaattaatggggaagtgattacgacg
ccatactcctttgtggcaactagccactctattatgtggaatggtctcgaaccggtattt
gtagatattgatccaactacatttaatattgatcctgagaaaattgaagctgctataacg
ccacgtactacagctatcatgcctgtacattgttattctaacccttgtgatgttgaggca
attcaaaagattgcagataactatggtctgaaagtaatatatgatgcagcacatgcgttt
ggcattaaatataaagggcagagtatacttaattggggtgatctttcaattttgagcttc
catgccactaaggtatttaatacttttgaagggggggcaattattagtccagatgctaaa
actaaacagcgaattgatcgtttgaagaactttggtattgcagatgaattaacagtaaca
gctcctggcattaatggaaagatgagtgaaattaatgctgcctttggtttggttcaatta
aaacatatagatcaagcaatgcaatctaggcaaattattgatgagcgttaccgtactgcg
ttgagagatgtgcctggcattacgatgtataaacataatccttatgcgaatagtaatttc
tcatattttccgatacttgtagataatgactataaacttagtcgagatgaactatatgaa
aagctaaaagataataacatcttgtcaagacgttatttctatccccttattagcaatatg
ccaatgtatcgtggtttagttagctctaatgctaaaaatttagagcatgccaatgttgtt
tcagataaggttttatgcttaccaatatttgatacgctaaaattagaagatcaattaaat
ataataaaattaatcaatgaggcgtga

DBGET integrated database retrieval system