KEGG   Aeromonas hydrophila AH10: VU14_08615Help
Entry
VU14_08615        CDS       T03886                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00220  Arginine biosynthesis
ahi00250  Alanine, aspartate and glutamate metabolism
ahi00290  Valine, leucine and isoleucine biosynthesis
ahi01100  Metabolic pathways
ahi01110  Biosynthesis of secondary metabolites
ahi01130  Biosynthesis of antibiotics
ahi01210  2-Oxocarboxylic acid metabolism
ahi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VU14_08615
   00290 Valine, leucine and isoleucine biosynthesis
    VU14_08615
   00220 Arginine biosynthesis
    VU14_08615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahi01007]
    VU14_08615
Enzymes [BR:ahi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VU14_08615
    2.6.1.66  valine---pyruvate transaminase
     VU14_08615
Amino acid related enzymes [BR:ahi01007]
 Aminotransferase (transaminase)
  Class I
   VU14_08615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AKA16928
UniProt: A0A081USC2
LinkDB All DBs
Position
complement(1902631..1903845)
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctatgacatccgcggcccg
gtgcataaagaagctcgccgtctcgaagacgaaggccaccgcatcatcaagctcaacatc
ggcaacccggccccgttcggtttcgatgcaccggaagagatcatcaaggatgtgatcctc
aacatgccgctcagccagggctactgcgactccaaggggctgttctcggcccgcaaggcg
gtgatgcagtactaccagcagaaagggatgcgcaaggtcgacatcgacgacatctacatc
ggcaacggcgccagcgagctgatcgtgatggcgatgcaggcgctgctcaacaacggcgac
gagatgctggtgccctcccccgactatccgctgtggactgcggcagtgaccctctccggc
ggccatgcggtgcactatcgctgcgacgaaggggccgactggtatccggatctcgacgac
atccgcgcccgcatcaccccgcgcacccgcggcctggtgctgatcaaccccaacaacccc
accggcgccgtctacggcagcgagttcctgctggaggtgatcgagatcgcccgccagcac
aacctcatcatcttcgccgacgaaatctacgacaagatcctctacgacgacatctcccac
accagcgtctgcaccctgtgcgacgatgtcatggtggtgaccttcaacggcctctccaag
gcctaccgcgcctgtggcttccgtcagggctggatggtcatcaccggtcccaagggccgt
gccaagggctacatcgaggggctggagatgctggcttccatgcggctgtgtgccaacgtg
ccgatgcagcacgccatccagaccgctctgggtggttaccagagcatcaacgagctgatc
ctgccaggcggccgcctgcgccgccagcgcgacaaggcgtgggagctgctcaacgacatt
ccgggcgtatcctgcgtcaaacccaagggggcgctctacatgttcccgcgcctcgacccc
aaggtgtacgacatccgcgacgaccagaagatggtgttcgacctgctgcagcaagaaaaa
ttgctgctggtgcagggcaccggcttcaactggccggcaccggatcacttccggctggtg
ttcctgccccgggaagaggagctggaagaggccatcggccgtctcgcccgcttcctcaag
ggctacaagcagtaa

DBGET integrated database retrieval system