KEGG   Aeromonas hydrophila AH10: VU14_08715Help
Entry
VU14_08715        CDS       T03886                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00473  D-Alanine metabolism
ahi01100  Metabolic pathways
ahi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VU14_08715
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VU14_08715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
    VU14_08715
Enzymes [BR:ahi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VU14_08715
Peptidoglycan biosynthesis and degradation proteins [BR:ahi01011]
 Precursor biosynthesis
  Racemase
   VU14_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKA16947
UniProt: A0A0F6KE83
LinkDB All DBs
Structure
PDB: 

Position
complement(1927471..1928697)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPKICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFTGRLMRV
RAATPAEVEQALPYKMEELIGSLVSAQGIADIAQRHHTNIPVHIALNSAGMSRNGIDLRL
ADSKEDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccacgctgatcctgggcctgctggccggtcaggccgtc
gctgccccttacctgccgctggccagcgatcatcgcaacggcgaagtgcagaccgccagc
aatgcctggctggaagtcgatctcggcgccttcgagcacaacatccagaccctcaaggat
cgcctcggtgacaaagggccgaagatctgcgccatcatgaaggccgacgcctacggccac
ggcatcgacctactggtcccctctgtggtcaaagccggcatcccctgcatcggcatcgcc
agcaacgaagaggcccgcgtggcccgcgagaagggcttcaccggccgcctgatgcgggtg
cgtgccgccaccccggccgaagtggagcaggccctgccctacaagatggaagagctcatc
ggcagcctggtgagtgcccagggcatcgccgacatcgcccagcgccaccacaccaatatc
ccggtgcacatcgcgctcaactccgccggcatgagccgcaacggcatcgatctgcgcctg
gctgactccaaggaagacgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatggggctggcccagttc
aagctggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggaagtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctgtacggtgactccatcccctcctacaccgagtacaagcgggtaatg
gcgttcaagacccaggttgcctccgtcaaccactacccggccggcaacaccgtcggttat
gaccgcaccttcactctcaagcgcgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgggcgctgagcaacaaggcctatgtgctgatccagggccagaaggtg
ccggtggtgggcaagacctccatgaacaccatcatggtggacgtgaccgatctcaaaggg
gtcaaacccggtgacgaggtggtgctgttcggccgccagggtgaggccgaggtgaaacag
gcggatctggaggagtacaacggcgccctgctggcagacatgtacaccatctggggctac
accaaccccaagaagatcaagcgctga

DBGET integrated database retrieval system