KEGG   Aeromonas hydrophila AH10: VU14_12110Help
Entry
VU14_12110        CDS       T03886                                 

Definition
(GenBank) NUDIX hydrolase
Organism
ahi  Aeromonas hydrophila AH10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AKA17561
LinkDB All DBs
Position
2692694..2693086
Genome map
AA seq 130 aa AA seqDB search
MIDKLAWLTFKDQQLLCARSHGKHIYYIPGGKREAGESDEAALMREIEEELAVALKPDTL
AFACEFSAQADGKPQGVNVRLRCYTGEADGTPVASAEIAELRWLDSRHMAEISPVSRLLF
AWLVEQKLIC
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacaaactcgcctggctgaccttcaaggatcagcaactgctctgtgcccgctcc
cacggcaagcacatctactacattcccggcggcaagcgcgaagcgggagagagcgacgag
gcggcgctgatgcgcgaaatcgaggaagagctggccgtggccctcaagccagacaccctg
gcgtttgcctgcgagttcagcgcccaggccgacggcaagccgcagggggtcaacgtcagg
ctgcgctgctacaccggcgaggctgacggcactcccgtcgcctcggcggagatcgccgag
ctgcgctggctagacagccgccatatggccgagatctcgccggtttcccggctgctgttt
gcctggctggtcgaacagaagctcatctgctga

DBGET integrated database retrieval system