KEGG   Aeromonas hydrophila AH10: VU14_12595Help
Entry
VU14_12595        CDS       T03886                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00020  Citrate cycle (TCA cycle)
ahi00190  Oxidative phosphorylation
ahi00650  Butanoate metabolism
ahi01100  Metabolic pathways
ahi01110  Biosynthesis of secondary metabolites
ahi01120  Microbial metabolism in diverse environments
ahi01130  Biosynthesis of antibiotics
ahi01200  Carbon metabolism
Module
ahi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ahi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VU14_12595 (sdhB)
   00650 Butanoate metabolism
    VU14_12595 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VU14_12595 (sdhB)
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VU14_12595 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     VU14_12595 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AKA17655
UniProt: A0A0F6KC74
LinkDB All DBs
Position
complement(2832094..2832810)
Genome map
AA seq 238 aa AA seqDB search
MNVTFSVYRYNPDVDNVPHMKEYRLDIPEGSDMMVLDALIQLKELDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPLSDLLKKGNNVVIRPLPGLPVIRDLVIDMTQFYTQWEKVKPF
LINDEKLPPVREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
WLADSRDTAATDRLGNLDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGQIKSMLLNRAV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcacattctctgtctacagatacaatccggatgttgataacgtcccccatatg
aaggaatatcgtcttgatattcctgaaggttccgacatgatggtgctcgacgcactgatc
cagctcaaagagctggatcccacgctcgccttccgccgctcttgccgcgaaggggtctgt
ggatctgacggtctcaacatgaatggcaagaacggtcttgcctgcatcaccccgctctcc
gatctgctgaagaagggcaataacgtcgttatccgccccttgccaggcctgccggtgatc
cgtgatctggtgatcgacatgacccagttctacacccagtgggagaaggtcaaacccttc
ctcatcaacgacgaaaaattgccgcccgtgcgtgagcacctgcaatcccccgaagagcgc
gccaagctggatggcctgtacgagtgtattctctgtgcctgctgctccacctcttgcccc
tccttctggtggaacccggacaagttcatcggcccggccggtctgctcgccgcctatcgc
tggctggcggacagccgcgataccgcggctaccgatcgactgggtaatctggatgacgcc
ttcagcgtgttccgttgccacggcatcatgaactgcgtgaacgtctgtcccaagggcttg
aacccgaccaaggccatcggtcagatcaagtcgatgctgctcaatcgggctgtttag

DBGET integrated database retrieval system