KEGG   Aeromonas hydrophila AH10: VU14_13035
Entry
VU14_13035        CDS       T03886                                 

Definition
(GenBank) type VI secretion protein
  KO
K11906  type VI secretion system protein VasD
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VU14_13035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ahi02044]
    VU14_13035
Secretion system [BR:ahi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VU14_13035
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AKA17736
LinkDB
Position
complement(2928548..2929060)
AA seq 170 aa
MIRALMLGAALLALAGCTTMGKMADVAMNPDIQVGSNDSQPTTLGLSLLAEPDVNPNESG
EAAPIEFQVVLLAEDSKLLATDYDQVTADVEKALGKNYLDHQDYTLLPGQFKYLPPIKLD
EKTRYIGVIARYADPDSAEWRKVIKIKSKGTAYQILVHLRLDEVELQKEE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgatacgtgcgctgatgctgggcgccgcgctgctggccctggcaggttgtaccaccatg
ggcaagatggccgacgtggccatgaacccggatatccaggtgggcagcaatgacagtcaa
ccgacgaccctggggctgagcctgctggcggagcctgacgtcaaccccaacgagagcggg
gaggcggcgcccatcgagtttcaggtggtgttgctggcggaggattccaagctgctcgcc
accgactacgaccaggtgaccgcggacgtggagaaggcccttggcaagaactacctggac
catcaggactacaccctgctgccgggccagttcaaatatctgccccccatcaagctcgac
gaaaagacccgttacatcggggtgatcgcacgctacgccgaccccgacagcgccgagtgg
cgcaaggtcatcaagatcaagagcaagggaacggcttatcaaatcctggtgcacctgcgc
ctggatgaagtggaactgcaaaaagaagaataa

DBGET integrated database retrieval system