KEGG   Aeromonas hydrophila AH10: VU14_13975Help
Entry
VU14_13975        CDS       T03886                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ahi  Aeromonas hydrophila AH10
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VU14_13975
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     VU14_13975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AKA17899
UniProt: A0A1C2L7N8
LinkDB All DBs
Position
complement(3125924..3126586)
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIPLDLSALDQKKPEFLAINPNGRIPAIVDRDN
GDFAVFESGAILLYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAHHEYLADEYSIADIATWPWVRIYDWSGISIEGLPH
LQAWMDRMAEKPACQKGITIPPRNEKPEDLVKQAQQMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttacaccgccgctacgcccaacggcttcaaggtggcgattgccttggaa
gagctgggcttgccctatcgggtgatcccgctcgatctgtcggcgctggatcagaagaag
cccgagtttctggccatcaaccccaatggccgtatcccggccatcgtcgatcgggataac
ggtgacttcgccgtgttcgagtccggcgccatcctcctctatctggcggagaaggcgggc
aagctgctgccggcagatcccaaacgtcgctcccaggccatccagtggttgatgttccag
atgggcggggtcggtcccatgatggggcaggccaacgtcttctatcgctacttcccggag
aagattccggccgccatcgagcgctaccagaaggagggacgccgtctgttcgaggtgctc
gacagccacctggcccatcacgaatatctggccgacgagtacagcatcgccgatatcgcc
acctggccctgggtgcgcatttatgactggagcggtatctccatcgaggggttgccccat
ctgcaagcctggatggaccggatggcagagaagcccgcctgtcagaaagggatcaccata
ccgccgcgcaacgagaagccggaggatctggtcaaacaggcccagcagatggtaacacgt
tga

DBGET integrated database retrieval system