KEGG   Aeromonas hydrophila AH10: VU14_19535Help
Entry
VU14_19535        CDS       T03886                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00620  Pyruvate metabolism
ahi00680  Methane metabolism
ahi01100  Metabolic pathways
ahi01120  Microbial metabolism in diverse environments
ahi01200  Carbon metabolism
Module
ahi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VU14_19535
  09102 Energy metabolism
   00680 Methane metabolism
    VU14_19535
Enzymes [BR:ahi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VU14_19535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA18948
LinkDB All DBs
Position
4363997..4366630
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSSRKGNETDRERLLDTL
RNLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDPLEQMFDKLKASNLSQE
AIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALELSDLLPRERDKILNRIEQ
LVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMRNLDERLQHHLGVRLPLDA
APVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYKDIKELTSELSMSDCTDAVR
ERVGDHPEPYRALVRELREQLRETQEFLTAKVQGQASESRDLVKTTAQLREPLELCYHSL
HACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERHGQVFSELTRYLGMGDYAEWSE
DDKQAFLLNELNSRRPLIPTDWEPSDETRETLDTCKVIAQHDPDAFGIYIISMAGAPSDV
LAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMERLLSVDWYRGYIQGRQYVMIGYSD
SAKDAGMMAAGWAQYAAMESLVALAEANNLRLTLFHGRGGTVGRGGAPAHQAILSQPPGS
LRGGLRVTEQGEMIRFKFGLPKVAIQSLNLYTSAVLEGNLLPPPKPKECWRAVMEQLATV
SCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLGSRPSKRKPNGGVESLRAIPWIFAWTQ
NRLMLPAWLGAHKGLQQAIADGQKSVLEEMSRQWPFFRTRLEMLEMVFLKADVWLAEYYD
TRLVPKELWGLGKQLRQELADSIQVVLELRPQGDLLDDQPWIKESIKLRNPYTDPLNVLQ
VELLGRSRNHAETLHPELDQALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagtacgccgcactacgcgccaacgtaggcatgctgggtcaactgctgggc
aagtccatcaaggatcatcagggacaggccttcctcgacaagatcgaaaccattcgccag
ctggccaaatcctcccgcaaaggcaatgagacagaccgggaacgtctgctcgataccctg
cgcaacctgagcgatgacgagctgctgccggtggcccgcgccttcagccagtttctcaac
ctggccaacgtggccgaacagttccacaccatctcccgtcgctgcgaagagcaggtctgc
accccggatccgctcgagcagatgttcgacaagctgaaagcctccaatctgtcccaggaa
gccatcatccaggccgtgcgcgagctggacatcgatctggtgctgaccgctcaccccacc
gaggtgacccgccgcaccctgatccacaagcacgtgcagctcaacgactgcctcgaggcg
ctggagctgtccgatctgctgccccgcgagcgggacaagatcctcaatcgcatcgaacag
ctggtcaaccaggcctggcacaccaacgagatccgcgaacagcgcccgaccccggtagac
gaagccaagtggggcttcgccgtggtggagaacagcctgtggccggccatccccgaattc
atgcgcaatctggacgagcggctgcaacaccacctgggtgtgcggctgccgctggatgcc
gcgccggtcaagttcacctcctggatgggcggtgaccgcgacggcaaccccttcgtcacc
gccaaggtgaccgccgaggtgctggagctgggccgctggatggcggtgagcctgttctac
aaggacatcaaggagctcacctccgagctctccatgtccgactgtaccgacgccgtgcgc
gaacgggtcggcgatcaccccgagccttaccgcgccctggtacgcgagctgcgcgaacag
ctgcgcgagacccaggagttcctcaccgccaaggtgcagggccaggcgagcgagagccgg
gatctggtcaagaccaccgcccagctgcgcgagccgctggagctctgctaccactccctg
cacgcctgcggcatgggcaacatcgccgacggcatgctgctggacgtgctgcgcaagctg
gcctgcttcggcatccacctggtcaagctggacatccgccaggatggcgaacgccacggc
caggtcttctccgagctgacccgctacctcggcatgggtgactacgccgagtggagcgag
gacgacaagcaagccttcctgctgaacgaactcaactcccgccgcccgctcattccgacc
gactgggagccgagcgacgagacccgcgagaccctggatacctgcaaggtcatcgcccag
cacgaccccgatgcgttcggcatctacatcatctccatggctggcgcaccgtccgacgtg
ctggcagtgcagctgttgctgaaagaggcaggctgcaagttccgcatgccggtcgccccg
ctgttcgagacccaggaagacctgatggcgggcaccgccgtgatggagcgcctgctgtcg
gtggactggtatcgcggctacatccagggccgtcagtacgtgatgatcggctactcagac
tccgccaaagacgcgggcatgatggccgccggctgggcccagtacgccgccatggaatcc
ctggtggcgctggccgaggccaacaacctgcgcctcaccctgttccatggccgtggcggt
accgtcggccgtggtggcgcccccgcccatcaggcgatcctgtcgcaaccgccgggatcc
ctgcgcggtggcctgcgggtgaccgaacagggcgagatgatccgcttcaagttcggcctg
ccgaaagtggccatccagagcctcaacctctacaccagcgccgtgctggaagggaacctg
ctgccaccgcccaaacccaaggagtgctggcgcgccgtgatggagcagctggcgaccgtc
tcctgcgatcactaccgcagtatcgtgcgcggtcatccggacttcgtgccctacttccgc
gccgccactccggagatggagctcggcaagctgccgctcggttcgcgcccctccaagcgc
aaacccaacggcggggtcgagagcctgcgcgccatcccctggatcttcgcctggacccag
aaccggctgatgctgccggcctggctcggcgcccacaaggggctgcagcaggccatcgcc
gacggccagaagagcgtgctggaagagatgagccgtcagtggcccttcttccgcacccgc
ctcgagatgctggagatggtgttcctaaaagctgacgtctggctggccgagtactacgac
acccggctggtgcccaaggagctgtggggcctgggcaaacagctgcgtcaggagcttgcc
gattccatccaggtggtgctggagctgcgcccgcagggcgacttgctcgacgaccagccc
tggatcaaggagtccatcaagctgcgcaacccctacacagacccgctcaacgtgctgcag
gtcgagctgctgggtcgctcgcgcaaccatgccgagaccctgcatcccgagctggatcag
gcgctgatggtcaccatcgctggtattgccgccggtatgcgcaacaccggttga

DBGET integrated database retrieval system