KEGG   Aeromonas hydrophila J-1: V469_02005Help
Entry
V469_02005        CDS       T03574                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00550  Peptidoglycan biosynthesis
ahj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    V469_02005
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    V469_02005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahj01011]
    V469_02005
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ahj03036]
    V469_02005
Enzymes [BR:ahj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     V469_02005
Peptidoglycan biosynthesis and degradation proteins [BR:ahj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   V469_02005
Chromosome and associated proteins [BR:ahj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    V469_02005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJE34766
LinkDB All DBs
Position
427767..429521
Genome map
AA seq 584 aa AA seqDB search
MKRKASAKAQPKVKAPSLYPWRFRTLVFFIGIAFAGLILRLAWIQVIDPDRLRQEGDMRS
LRTTSTQAVRGMITDRNGEQLAVSVPVEAVWADPKTVHESGAIHNERAWLALSAVLKLDI
NTLKHRISNPSKRFVYLQRQVTPAVAEYIKGLKLGGIYLRPEARRFYPTGEISAHLVGVT
NIDGSGIEGIERSYNEWLTATPGEMRVRKDRQGRVIERLGLVKEGKNANDLQLSIDQRVQ
ALAYRALKRATDENKATSGSMVMLDVKTGEVLAMVNTPSYNPNNRGQYQSFRVRNRVVTD
TYEPGSTVKPLILLSALQAGVTSWKDTIPGGPLFIGAKQIRDVSIHKATNLYDILRYSSN
IGMSRIALRMPAQEMINTLSMVGFGMDTGSGLMGESSGMLPQRRRWSDIERATLSFGYGL
RVTPLQLASAYATLANKGKRVPLSIVKVTEPPKGEQVIDHNNATAMLQALEYVVSNAIPK
AQIPGYRVGGKSGTAKVAVAGGYGKDYMAWFAGFAPASNPRFVMVVVINEPKGDAYYGGA
VATPPFAEAMGGVLQLFNIRPDAVPPAVPTKLARTEASNVVPRT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaggcttccgccaaggcccaacccaaggtcaaagctccgtcactctatccg
tggcgctttcgcacgctggtgttcttcatcggcattgcgtttgccggcttgatcctgcga
ctggcctggatccaggtgatcgacccggatcggctgcgccaggaaggggacatgcgttcg
ctgcgtaccacctccactcaggccgtgcgcggcatgatcaccgatcgcaacggcgaacag
ctggcggtttcggtgcctgttgaggctgtctgggccgatcccaagacggtgcatgaatcc
ggcgccatccataacgagcgggcctggctggccctgtccgccgtgctcaagctcgacatc
aacaccctcaagcaccgcatctccaacccgagcaagcgcttcgtctacctgcagcgtcag
gtgacgccggcggtggcggaatacatcaagggcctcaagctgggcggcatctatctgcgc
cccgaggcgcgccgtttctacccgaccggcgagatcagcgcccacctggtgggggtaacc
aacattgacggcagcggcatcgaggggattgagcgcagctacaacgaatggctgacggca
acccctggcgagatgcgggtgcgcaaggacaggcagggccgggtcatcgagcggcttggt
ctggtcaaagagggcaagaacgccaacgacctgcaactgagcatcgatcaacgggtgcag
gcgctggcctaccgggcgctcaagcgcgccaccgacgagaacaaggcgacctccggctcc
atggtgatgctggacgtcaagaccggcgaagtgctcgccatggtcaacaccccctcctac
aatcccaataaccgcggccagtaccagagtttccgggtgcgcaaccgggtggtgaccgat
acctatgaaccgggctccaccgtcaagccgttgatcctgctcagcgccctgcaggccggc
gtcaccagctggaaggacaccattccgggtggccctttgttcatcggggccaagcagatc
cgcgacgtgagtatccacaaggcgaccaacctgtacgacatcttgcgctactcctccaac
atcggcatgtcgcgcatcgcgctgcggatgccggcgcaggagatgatcaacaccctcagc
atggtgggcttcgggatggataccggcagcggcctgatgggtgagagcagcggcatgctg
ccccagcgccggcgctggtccgatatcgaacgggccaccctgtcgttcggctatggcctg
cgggtcaccccgctgcagctggcctccgcctatgccaccctggccaacaagggcaagcgg
gtgccgctctccatcgtcaaggtgactgagcctcccaagggggagcaggtcatcgatcac
aacaacgccaccgccatgttgcaggcgctggagtacgtggtcagcaatgccattccgaaa
gcacagatccccggttaccgcgtcggcggcaagagtggtaccgccaaggtcgcggtcgcg
ggtggctacggcaaggactacatggcctggttcgccggtttcgccccggccagcaatccc
cgtttcgtcatggtcgtggtgatcaacgagcccaagggcgacgcctactacggtggcgcc
gtggcgacaccgccgtttgccgaagccatgggcggggtgctgcagctcttcaatattcgt
cccgacgcggtgccgcctgcggtgcccaccaaacttgcccgtacggaggcttccaatgtt
gtcccgcgcacttga

DBGET integrated database retrieval system