KEGG   Aeromonas hydrophila J-1: V469_04525Help
Entry
V469_04525        CDS       T03574                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00061  Fatty acid biosynthesis
ahj00780  Biotin metabolism
ahj01100  Metabolic pathways
ahj01212  Fatty acid metabolism
Module
ahj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    V469_04525
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    V469_04525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahj01004]
    V469_04525
Enzymes [BR:ahj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     V469_04525
Lipid biosynthesis proteins [BR:ahj01004]
 Fatty acid synthase
  Component type
   V469_04525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_C ketoacyl-synt Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJE35215
LinkDB All DBs
Position
944445..945629
Genome map
AA seq 394 aa AA seqDB search
MSCYIAAYGLVSALGMGRDASAEALLAWQQSGVSPLDRHRAPLLDGRQTPVGRVEGELPA
IPAALAPYASRNNQLLLAALAQVRPALDEALAAHGPARVGLVLGTSTAGIGEAELAVAAA
RRGEAVPPAFDYRQQELGSPSEFLARHLGLTGPAWTISTACSSSARAFISGQRLLAAGLV
DAVLVGGADSLCGLTLNGFDSLESLSCARCQPFDEARQGINIGEGAALFLLSRTPAPLAL
LGAGESSDAWHISAPHPDGIGAEAAMQMALAQAGLTPAQVGYVNLHGTATRLNDAMESQA
VHRLFGAEVPCSSTKPLTGHALGAAGAIEAALACLLLERALPLPPQRVTTADPALAPIRL
VSGEVPLAAPRVLSNSFAFGGNNVSLLFGSVHHE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagttgttatatcgccgcctatggcctcgtctcggcattggggatggggcgcgatgcc
agcgccgaggcgctgctggcctggcagcagtcgggcgtgagcccgctggatcgccaccgg
gcgccgctgctggatggccgtcagaccccggtggggcgggtggagggggagttgccggcc
ataccggcggcgctggctccttatgcttcgcgcaacaaccagctgctgctggcagcgctg
gcccaggtgcggcccgctctcgacgaggcgttggcggcgcatggccctgcgcgagtgggg
ctggtgcttggcaccagcaccgccgggatcggcgaggccgagctggcggtggcggctgcc
cggcgcggggaggccgtgccgcccgcctttgactatcgccagcaggagctgggctcgccg
tcggaatttctggcccgccacctcggcctgaccgggccggcctggactatctccaccgcc
tgctcctccagcgcgcgcgccttcatcagcggccagcggctgctggcggccgggctggtg
gacgccgtgctggtgggcggcgccgacagtttgtgcgggctcactctcaacggcttcgac
agcctggagtccctcagctgtgcgcgctgccagccatttgatgaggcgcgccaggggatc
aacatcggcgagggggcggcgctgttcctgctgagccgcacgcctgcaccgctggcgctg
ctgggggcgggggagtcctccgatgcctggcacatctcggcgccccatccagacggtatc
ggcgccgaggcggccatgcagatggcgctggcccaggcgggcctgacgccggcgcaggtg
ggctacgtcaacctgcacggcaccgccacccgcctcaacgacgccatggagagccaggcg
gtgcatcggctgtttggtgccgaggtgccctgcagctccaccaagccgctcaccggccat
gccctgggggcggcgggggccatcgaagcggcgctcgcctgcctgctgctggagcgcgcc
ctgccgctgccgccccagcgggtgacgacggcggatccggcgctggcgccgatccggctg
gtgagcggcgaggtgccgcttgcggcgccccgggtgctctccaactcctttgccttcggt
ggcaacaatgtcagcttgctgtttgggagcgttcaccatgaatga

DBGET integrated database retrieval system