KEGG   Aeromonas hydrophila J-1: V469_09600Help
Entry
V469_09600        CDS       T03574                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ahj01100  Metabolic pathways
ahj01110  Biosynthesis of secondary metabolites
ahj01130  Biosynthesis of antibiotics
ahj01230  Biosynthesis of amino acids
ahj02024  Quorum sensing
Module
ahj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    V469_09600
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    V469_09600
Enzymes [BR:ahj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     V469_09600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AJE36122
LinkDB All DBs
Position
2102595..2103650
Genome map
AA seq 351 aa AA seqDB search
MQHQTDDVRISEIKELLPPVAVLEKFPATETASSTVFESRQAIHQILAGEDQRLLVVIGP
CSIHDPAAALEYGKRLKVLRDELKGQLEIVMRVYFEKPRTTVGWKGLINDPYLDNSCQIN
DGLRIGRKLLLDLNDMGLPTASEFLDMITPQYVADLMSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGTIKVAIDAIGAASAPHHFLSVTKYGHSAIVATRGNPDCHIILRGGREPN
YSAAHVDEVVKGLDKAGLPQKVMIDFSHANSSKQFKNQMLVAEDVAGQLRAGSRAVFGVM
VESHLVEGRQDLVEGCELTVGQSITDACIGWADTEILLRNLADAVATRNAG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcaaaccgacgacgttcgtatcagtgaaatcaaagagttattgcccccggtt
gcggtgcttgagaagtttccggccaccgagaccgcatcaagtaccgtctttgaatcccgt
caggccatccatcagatcctggccggtgaagatcagcgcctgctggtggtgatcggtccc
tgttccattcacgaccccgccgctgcgctggagtacggcaagcgcctcaaggtgctgcgt
gacgagctcaagggccagctggagatcgtgatgcgggtctacttcgagaagccgcgtacc
acggtgggatggaaggggctgatcaacgacccttacctcgacaacagctgccagatcaac
gacggcctgcgcatcggtcgcaagctgctgctggatctcaacgacatggggctgccgacc
gcctccgaattcctcgacatgatcaccccgcaatacgtggcggatctgatgagctggggc
gccatcggggcccgtaccaccgaatcccaggtgcaccgcgagctggcctccggtctctcc
tgcccggtgggcttcaagaacggcaccgacggcaccatcaaggtggccatcgacgccatc
ggggccgccagtgcgccgcaccacttcctgtcggtgaccaagtacggccactccgccatc
gttgccacccggggcaacccggactgccacatcatcctgcgcggcggtcgtgagccgaac
tacagcgccgcccacgtggacgaagtggtgaaggggctggacaaggccggtctgccgcag
aaggtgatgatcgacttcagccacgccaacagcagcaagcagttcaagaaccagatgctg
gtggccgaggacgtggccggtcagctgcgtgccggcagccgggctgtgttcggcgtcatg
gtggagagccatctggtggaagggcggcaggatctggtggaagggtgcgagctcaccgtc
ggtcagagcatcacagatgcctgcatcggctgggccgacaccgaaatcctgctgcgcaat
ctggccgatgcggtggccacccgcaacgcaggctga

DBGET integrated database retrieval system