KEGG   Aeromonas hydrophila J-1: V469_10980Help
Entry
V469_10980        CDS       T03574                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ahj  Aeromonas hydrophila J-1
Brite
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     V469_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJE36338
UniProt: A0A1U6XZM1
LinkDB All DBs
Position
2399346..2399861
Genome map
AA seq 171 aa AA seqDB search
MNNRLSKVMLAAVLVTSVNATAATVTMKDLASGAVVGHVELSESPYGAVFTPALSSLPAG
LHGFHVHANGSCDSSMKDGQSVAGGAAGGHYDPQQTGRHGAPWQDDAHKGDLPPLYVDDA
GKAVQPVLAPRLTLAELSGKALMVHAGGDNHSDHPAPLGGGGARVVCGIIP
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccgattgagtaaagtgatgcttgcagcagtactggtaacaagcgtcaatgcc
accgcagctacagtgacgatgaaggatctggccagtggggcagttgttgggcatgtcgag
ttgagtgaaagtccttatggcgcagtctttactccggcgctgtcctctttacctgccggt
ctgcacggattccatgtgcacgccaacgggagctgcgacagcagtatgaaggatggacaa
agcgttgcggggggcgcggccggtggtcactatgacccccaacaaaccgggcgccatggt
gccccctggcaagatgatgcccacaagggggatttaccacctctctacgtcgatgatgca
ggtaaagctgtacaaccggtgctggcaccgcgccttaccctggcggagctgagtggtaag
gcattgatggtccatgccggcggtgataaccactccgatcacccagcccccctaggtggc
ggtggtgcgagagttgtctgcggtatcatcccatga

DBGET integrated database retrieval system