KEGG   Aeromonas hydrophila J-1: V469_13670Help
Entry
V469_13670        CDS       T03574                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ahj  Aeromonas hydrophila J-1
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    V469_13670
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     V469_13670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C Glutaredoxin K_oxygenase FMO-like FMN_bind
Motif
Other DBs
NCBI-ProteinID: AJE36833
LinkDB All DBs
Position
2997287..2998867
Genome map
AA seq 526 aa AA seqDB search
MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALAGEIAEMSPKITQTSGTNARK
PSMSVAPKGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADAAVQEQIRNLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGAAERKAEELSAKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEYVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSDVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEATKADAVTA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggataccaacctcaaacaacaactgaacacctatctgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaacgacagcgacaaatccgccgaactgctggccttggcc
ggcgagatcgccgagatgtcacccaagattacccagacctctggcaccaatgcccgcaag
ccttccatgagcgtcgcgccgaagggccaggccccgcgcgttcattttgccggcatcccc
atgggtcatgaattcacttccctggtccttgccctgctgcaaagcggcggtcacccctcc
aaggccgatgcggccgtgcaggagcagatccgcaatctcaagggtgagttccacttcgag
acttacatttcgctctcctgccacaactgcccggacgtggtgcaggccctcaacctgatg
gcgaccctgaaccccggcatcacccacaccatgatcgacggtgccctgttccaggacgag
gtcaacgagcgtcagatcatggcggtaccgaacgtctacctgaacggtcagccgttcagc
cagggccgcatttcgctcgaagagatcgtcgccaagctcgacaccggcgccgccgaacgc
aaagctgaagagctgagcgcaaaagcgccttacgacgtgctggtcgtcggtggtggcccg
gctggcgcagccgccgccatctatgccgctcgcaaaggcattcgcaccgccatcgtcgcc
gagcgtttcggtggccaggtgatggacaccgtaggcatcgagaacttcatctccgtgccc
tacaccgaaggccccaagctggccgcgagcctggagcagcacgtcaagcagtacggcgtg
gaagtgatcaccgagcagcgcgccgccgccatcagcaaggatggctacgtcaatgtggat
ctcgcctctggcgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgtgacctgaacgtgccgggcgagctcgagtaccgcaccaagggcgtggcctactgcccg
cactgtgacggccccttcttcaagggcaagcgggtcgcggtgatcgggggcggcaactcc
ggtatcgaggcagccatcgatctggctggcatcgtcgagtacgtcaccgtggtggagttt
gccgacaccctgcgcgccgacgaggtgttgcagaagaaggcccgctccatgggcaacatc
gacatcatcatgagcgcccgcaccaccgaagtgatcggtgacggcagcaaggtggtgggc
atggattacgaagatcgcaccaccggcgagatcaagcatctggcggtggccggcatcttc
gtccagatcggtctggtgccgaacaccgagttcctgaaagggagcgacgtcgccctgacc
cgctttggcgagatcgagatcgacaccaagggcgctacctccctgcccggcgtctacgcc
gcaggggacgccaccacggtgccgttcaagcagatcatcatctccatgggcgccggggcg
accgccgcactgggagcgtttgattacctcattcgcaatccggcgccggaagcgaccaaa
gctgacgccgtcaccgcctga

DBGET integrated database retrieval system