KEGG   Aeromonas hydrophila J-1: V469_16820Help
Entry
V469_16820        CDS       T03574                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00061  Fatty acid biosynthesis
ahj00780  Biotin metabolism
ahj01100  Metabolic pathways
ahj01212  Fatty acid metabolism
Module
ahj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    V469_16820
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    V469_16820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahj01004]
    V469_16820
Enzymes [BR:ahj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     V469_16820
Lipid biosynthesis proteins [BR:ahj01004]
 Fatty acid synthase
  Component type
   V469_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AJE37431
LinkDB All DBs
Position
complement(3695709..3696170)
Genome map
AA seq 153 aa AA seqDB search
MTTEKKSLGIQEIMDLLPHRYPFLMVDKVENYEISDERKTLRAIKNVSFNEPIFQGHFPA
KPVFPGVLILEAMAQATGILAFTMVGKPSPNELYYFASIDNARFKRPVGPGDQLVLDVEF
LKERRGIAKFTGVATVNGEVVCTAELMCAKREV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgaaaagaagagcctgggtatccaggaaatcatggatctgctgccccaccgt
tatccgttcctgatggtggacaaggtggaaaactacgagatcagcgatgagcgcaagacc
ttgcgtgccatcaagaacgtctcgttcaacgagccgatctttcagggccacttcccggcc
aagccggtgttccccggcgtgctgatcctggaagccatggcacaggccaccggtatcctg
gcgtttaccatggtgggcaagccgtctcccaacgaactctattactttgcctcaatcgac
aacgctcgtttcaagcgtccggtgggccccggcgatcagctggtgcttgacgtggaattc
ctgaaagagcgtcgcggtatcgccaagttcaccggtgtggccacggtcaacggtgaagtg
gtctgtaccgccgagctgatgtgcgccaaacgcgaggtttaa

DBGET integrated database retrieval system