KEGG   Aeromonas hydrophila J-1: V469_22525Help
Entry
V469_22525        CDS       T03574                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00071  Fatty acid degradation
ahj00280  Valine, leucine and isoleucine degradation
ahj00281  Geraniol degradation
ahj00310  Lysine degradation
ahj00362  Benzoate degradation
ahj00380  Tryptophan metabolism
ahj00410  beta-Alanine metabolism
ahj00640  Propanoate metabolism
ahj00650  Butanoate metabolism
ahj00903  Limonene and pinene degradation
ahj00930  Caprolactam degradation
ahj01100  Metabolic pathways
ahj01110  Biosynthesis of secondary metabolites
ahj01120  Microbial metabolism in diverse environments
ahj01130  Biosynthesis of antibiotics
ahj01200  Carbon metabolism
ahj01212  Fatty acid metabolism
Module
ahj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    V469_22525 (fadB)
   00650 Butanoate metabolism
    V469_22525 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V469_22525 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V469_22525 (fadB)
   00310 Lysine degradation
    V469_22525 (fadB)
   00380 Tryptophan metabolism
    V469_22525 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    V469_22525 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    V469_22525 (fadB)
   00281 Geraniol degradation
    V469_22525 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V469_22525 (fadB)
   00930 Caprolactam degradation
    V469_22525 (fadB)
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     V469_22525 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     V469_22525 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     V469_22525 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     V469_22525 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Phage_TAC_11
Motif
Other DBs
NCBI-ProteinID: AJE38474
LinkDB All DBs
Position
4887760..4889907
Genome map
AA seq 715 aa AA seqDB search
MIYQGETLTVSYLEDGIAELRFDAPGSVNKLDRATLLSLSEAIATLQQERELKGLILTSG
KDAFIVGADITEFLELFDLPQADLLGWLKKANDIFSAIEDLPVPTLCAIKGHALGGGCET
ILSTDFRLADTSAKIGLPETKLGIMPGFGGTVRLPRVIGADNALEWITTGKDYRADDALK
VGAVDAVVAPDALQGAALQMIKDAIRGKLDWQGRRAAKKAPLRLSKLEAMMSFTTAAGMV
AAVAGKHYPAPMTAVKTVEAAAGMSRDEALAVEAQGFIKLAKTDVAKALVGIFLNDQHIK
ALAKKAAKQAAKATSHAAVLGAGIMGGGIAYQSASKGIPAVMKDINEKALALGMNEATKL
LNSQLEKGRIDGIKMGQVLSAITPTLSYDNVKHVDVVVEAVVENPKVKAAVLGEVEGIIG
EDAVLASNTSTIPISLLAKGLKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDETINRVVA
YAAAMGKSPVVVNDCPGFFVNRVLFPYFFGFNKLVADGADFAAVDKVMEKEFGWPMGPAY
LLDVVGIDTGHHAGDVMAQGFPARMSKEGRTAIDVMYEVNRFGQKNGKGFYAYEQDKKGK
PKKVADAASYELLAPIAKPKQDFDKDAIIARMMIPMINEVVLCLEEGIVATPAEADIALV
YGLGFPPFRGGVFRYLDTIGLDRYVAMADQYADLGPLYRVSDKLREMAAQGKTFY
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaggcgaaaccctgacggtcagctacctcgaagacggcattgccgagctg
aggttcgatgctccgggttcagtcaacaagctggatcgcgctaccctgctctccctgagc
gaagcgatcgccacattacaacaagaacgtgaactaaaaggtctgatcctcacctccggc
aaagacgccttcatcgtcggcgccgacattaccgaattcctggaactgttcgatctgccg
caggctgatctgctcggctggctgaaaaaggccaacgacatcttcagcgccatcgaagat
ctgccggtgcccaccctctgtgccatcaagggccacgccctaggcggcggctgcgagacc
attctctccaccgacttccggctggctgacaccagcgccaagattggcctgcccgagacc
aagctcggcatcatgcccggctttggcggcaccgtccgtctgccgcgagtgatcggcgcc
gacaacgcgctggagtggatcaccaccggcaaggattaccgtgccgatgacgccctcaag
gtgggtgccgtcgacgcagtggtcgcccccgacgcgctgcagggcgctgcgctgcagatg
atcaaggacgcgatcagaggcaagctggactggcagggccgccgcgccgccaagaaggcc
ccgctgcgtctctccaaactggaagccatgatgagcttcactaccgccgccggcatggtt
gccgccgtggcgggcaaacattacccggcgccgatgacggcggtaaaaaccgtcgaagcg
gctgccggcatgagtcgtgacgaggcgctggccgtcgaggcacagggtttcatcaagctg
gccaagaccgatgtcgccaaggcgctggtcggtatcttcctcaacgatcagcacatcaag
gcactggccaagaaggctgccaagcaggcagctaaggccactagccacgccgccgtactg
ggtgccggcatcatggggggcggcatcgcctaccagtctgccagcaagggcatcccggcg
gtgatgaaagacatcaacgagaaggcgctggcacttggcatgaatgaggccaccaagctg
ctcaacagccagctcgagaagggccgcatcgacggcatcaagatgggccaggtgctctcc
gccatcacgccgaccctcagctatgacaacgtcaaacatgtggacgtagtggtcgaagcc
gtggtcgagaacccgaaggtgaaggccgccgtactgggcgaagtggaagggatcatcggc
gaagacgccgtgctcgccagcaacacctccaccatccccatctccctgctggccaagggg
ctgaagcgcccgcaaaacttctgcggcatgcacttcttcaacccggtgcaccgcatgccg
ctggtggagatcatccgcggcgagcagacctccgatgaaaccatcaaccgcgtggtggcc
tacgccgccgccatgggcaagtccccggtcgtggtcaacgactgccctggcttcttcgtc
aaccgcgtgctgttcccctacttcttcggcttcaacaagctggtcgccgatggcgccgac
ttcgctgccgtcgacaaggtaatggagaaagagttcggctggccgatgggccccgcctac
ctgctggacgtggtcggcatcgacaccggccaccatgccggtgacgtgatggcacagggc
ttcccggcacgcatgagcaaggaaggtcgcaccgccatcgacgtgatgtacgaagtgaac
cgcttcggtcagaagaacggcaagggcttctacgcctacgagcaggacaagaagggcaaa
ccgaagaaggtggccgacgcagccagttacgagctgctggctcccatcgccaagccgaaa
caggatttcgacaaggacgccatcatcgcccgcatgatgatcccgatgatcaacgaggtg
gtgctctgtctggaagagggcatagtcgccacgccagccgaagccgatatcgcgctggtc
tacggtctgggcttccctcccttccgcggcggcgtgttccgctatctggacaccattggt
ctggatcgctacgtggccatggccgaccagtatgccgacttgggcccgctctaccgcgtc
agcgacaagctgcgtgagatggccgcccagggcaaaaccttctactga

DBGET integrated database retrieval system