KEGG   Acinetobacter haemolyticus: AHTJS_04015Help
Entry
AHTJS_04015       CDS       T04618                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00020  Citrate cycle (TCA cycle)
ahl00190  Oxidative phosphorylation
ahl00650  Butanoate metabolism
ahl01100  Metabolic pathways
ahl01110  Biosynthesis of secondary metabolites
ahl01120  Microbial metabolism in diverse environments
ahl01130  Biosynthesis of antibiotics
ahl01200  Carbon metabolism
Module
ahl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ahl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHTJS_04015
   00650 Butanoate metabolism
    AHTJS_04015
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AHTJS_04015
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AHTJS_04015
    1.3.5.4  fumarate reductase (quinol)
     AHTJS_04015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like NAD_binding_8 FAD_binding_3 Pyr_redox_3 NAD_binding_7 FAD_oxidored Lycopene_cycl Pyr_redox
Motif
Other DBs
NCBI-ProteinID: APR69636
UniProt: A0A1L6KKL7
LinkDB All DBs
Position
823220..825112
Genome map
AA seq 630 aa AA seqDB search
MATTPNENYSNIQTLSFDAVIVGGGGSGMRAAYQLAQAGLKVAVLTKVFPTRSHTVAAQG
GIGASLGNMQEDNWHYHFYDTVKGSDWLGDQDAIEFMTREAPKVVYELEHLGMPFDRNED
GTIYQRPFGGHSANYGEKAVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLIR
NEEGDVLGVTAYDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAGI
PLQDMEFWQFHPTGVAGAGVLLTEGCRGEGGILRNKDGEPFMERYAPTLKDLAPRDFVSR
SMDQEIKEGRGCGPKADYILLDMTHLGAETIMKRLPSVFEIGKKFANVDCTKEPIPVVPT
IHYQMGGIPTNIHGQVVVPHGVEEGEFSAHYDKDTKEYTYKGTRDYVKPVKGFYAIGECS
CVSVHGANRLGTNSLLDLVVFGKAAGEHIIDYVTKHHGDDYAPLPNDVLENTLARVRKLD
ESTSGENAQEVADAIRDIVQDHAGVFRTQALLDKGVKEILAIEPRVRNIHLKDKSKVFNT
ARVEALEVENLYEVAKATLISAAARKECRGAHTVVDYELAPDHPTYSYGRRDDEWMKHTL
WYSSDNRLEYKPVRFSPLTVEAIEPKPRTF
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacccctaatgaaaattattcaaacatccagaccttatcattcgatgcagtc
atcgttggtggtggtggttctggtatgcgtgcagcttaccaacttgctcaagcgggtttg
aaggttgcagtattaaccaaagtattcccaacacgttcgcatacagttgctgctcaaggt
ggtatcggtgcgtcgttaggtaacatgcaagaagataactggcactatcacttctatgac
acggtaaaaggttctgactggttaggtgatcaggacgctatcgagttcatgacgcgtgaa
gcgccaaaagttgtatatgagcttgaacacttgggtatgccgtttgaccgtaacgaagat
ggtacgatctatcaacgtccatttggcggtcactctgcaaactatggtgaaaaagcggtt
ccacgtgcttgtgctgctgctgaccgtactggacatgcattgcttcatacgctttatcaa
agcaacgtgaaaatgggtactcagttcttcgttgaatggattgcattagatttaatccgt
aatgaagaaggtgatgtacttggtgtaactgcatacgatcaagaaacaggtaatattgca
gtattccaagcgaaagctacattatttgctacaggtggtgcgggtcgtgtgtatcgtgca
tcaaccaatgcttatatcaatactggtgacggtcttggtatggctgcgcgtgcaggtatt
ccattgcaagatatggaattctggcagttccacccaacaggtgttgcgggcgcgggtgta
ttgttgacagaaggttgtcgtggtgaaggtggtatccttcgtaacaaagacggcgaaccg
ttcatggaacgttatgcaccaactttaaaagacttggctcctcgtgatttcgtatcacgt
tcaatggaccaagagattaaagaaggtcgtggttgtggtccaaaagcagattatatctta
ttagatatgacgcatttgggtgctgaaacgattatgaagcgtcttccatctgtatttgag
attggtaaaaaattcgcaaacgttgactgtactaaagaacctatcccagttgtaccaaca
atccattatcaaatgggtggtattccaaccaatattcatggtcaagtggttgtgccacat
ggtgttgaagagggtgaattctctgcgcattatgataaagacacgaaagaatatacctat
aaaggtacacgtgattatgtgaagcctgtaaaaggtttctatgcaattggtgagtgttct
tgtgtatctgtacatggtgcaaaccgtttaggtacgaactcgttgcttgaccttgtggta
tttggtaaagctgctggtgaacatatcattgattatgtaactaagcatcacggtgatgac
tatgcaccattaccaaatgatgtactagaaaatacattggcgcgtgtgcgtaaattagat
gagtctacatctggtgaaaatgcacaagaagttgctgatgcgattcgtgatatcgtacaa
gatcatgctggtgtattccgtacacaggcattacttgacaagggtgtgaaagagatcctt
gcgattgaaccacgtgttcgcaatattcacttgaaagacaaatctaaggtatttaacact
gcgcgtgtagaagcattagaagtggaaaacttgtatgaagttgcaaaagcaaccttgatt
tctgctgctgctcgtaaagagtgtcgtggtgcgcatacggttgttgactatgagttagca
cctgatcacccaacttattcttacggtcgtcgtgatgatgagtggatgaagcatacatta
tggtactcatcagacaaccgtcttgaatataagccagtacgtttcagcccattaacggtt
gaagcaattgaaccaaaaccacgtacattctaa

DBGET integrated database retrieval system