KEGG   Acinetobacter haemolyticus: AHTJS_04020Help
Entry
AHTJS_04020       CDS       T04618                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00020  Citrate cycle (TCA cycle)
ahl00190  Oxidative phosphorylation
ahl00650  Butanoate metabolism
ahl01100  Metabolic pathways
ahl01110  Biosynthesis of secondary metabolites
ahl01120  Microbial metabolism in diverse environments
ahl01130  Biosynthesis of antibiotics
ahl01200  Carbon metabolism
Module
ahl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ahl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHTJS_04020 (sdhB)
   00650 Butanoate metabolism
    AHTJS_04020 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AHTJS_04020 (sdhB)
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AHTJS_04020 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AHTJS_04020 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_9 Fer4_7 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: APR69637
UniProt: A0A1L6KKM3
LinkDB All DBs
Position
825127..825837
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVQDETLTFRRSCREG
ICGSDGVNINGKNGLACLWNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYNKIQPFL
INNQPAPPKERLQSQEEREHLDGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATQERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggcactcgtacattcgaaatctaccgctatgatcctgataaggacaaagcg
ccgtacatgcaaacttttaaacttgagttaacggataagcatcgtatgttgcttgatgcg
ttacttgcgttgaaagttcaagatgaaacattaacgttccgtcgttcatgccgtgaaggt
atttgtggttcggatggtgtaaacatcaatggtaaaaatggtttggcttgtttatggaat
ttaaacgacctacctgagaaaattgtgattcgtcctttgcctggtttaccagtggtaaaa
gacttggttgtagatatgaaccagttctacgatcaatataacaaaattcagccattcttg
attaacaaccagccagctccgccaaaagagcgtctacagtctcaagaagagcgtgagcac
ttagatggtttgtatgaatgtattctttgtgcatgttgttcaacgtcttgtccatcattc
tggtggaaccctgataagttccttggaccatcagcgttgttaaatgcatatcgctttatt
attgattctcgcgatacagcaacgcaagaacgtttggctcgtttagatgatccattctct
ttgttccgttgtaagggaatcatgaactgtgtatctgtatgtcctaaaggtctgaacccg
acaaaggcaattggtcacattcgtaatatgttgttggatcaagcgggctaa

DBGET integrated database retrieval system