KEGG   Acinetobacter haemolyticus: AHTJS_06970Help
Entry
AHTJS_06970       CDS       T04618                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ahl  Acinetobacter haemolyticus
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AHTJS_06970
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AHTJS_06970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 DAO NAD_binding_7 K_oxygenase Thi4 AlaDh_PNT_C NAD_binding_8 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: APR70142
UniProt: A0A1L6KM43
LinkDB All DBs
Position
1405352..1406917
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDDSDKAAKVKELVTEIAELSDQVTARFDGSNAR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKGLNLKANF
DVFISLSCHNCPDVVQALNLIAIYNPNTTTTMIDGAFFQDEVEQRKILAVPMVFQDEQHI
GQGRMTLEEIIAKLDTNSAEKDAAMINAKDAFDVLVIGGGPAGATAAIYAARKGIKTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKVTGADQTAT
GLVEVELENGAKLESKTIILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLSNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDQKHVVELAGIFVQIGLLPNTDFLKDSAVELSNRGEIMVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYMIRSGV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatattaaaactcaattaaaagcttacttagaacgtttagaaagtcca
atcgagttggtggctgctttagatgattcagataaagcagcgaaagtaaaagaacttgtg
actgaaattgctgaactgtctgatcaagttacggcgcgttttgacggttcaaacgctcgc
cgtccgagttttggtgttgccaaagcaggtgaacaacctcgtgtgttctttgcgggttta
ccaatgggacatgagtttacttctttgatcttggcattgttacaagtttcaggctatgcc
cctaaagtttctgatgaggttttaaatcagatcaaaggcttaaatcttaaagcaaacttt
gatgtgtttatttcattgagctgccataactgtccagatgtagttcaagccttgaacttg
attgcaatctataacccaaataccacgaccaccatgattgatggtgcgttcttccaagat
gaagtggaacaacgcaaaatcctggctgtgccaatggtgttccaagatgagcaacatatc
ggtcaaggtcgcatgactttggaagaaatcattgccaagttagatactaactctgcggaa
aaagatgctgcgatgatcaatgccaaagatgcatttgatgtcttggtaattggtggtggt
cctgcgggtgcaactgcggcaatctatgcagcacgtaaaggaattaaaacaggtatcgtc
gctgagcgctttggtggtcaggtcatggataccatggatattgaaaactttacctcagtg
caaaagacccaaggtccaaagtttgcggctgaaatggaagcacatgtccgtgagtatgat
gtcgatatcatgaatcttcaacgtgtgagcaaagtgactggtgcggatcaaacagcaacg
ggcttggttgaggttgaactggagaatggtgccaaactagaatccaaaactattattctt
tcaactggtgcacgttggagagagatgaatgtaccgggtgaagctgaatatcgtacccgt
ggtgtcgcttattgcccacactgtgatggtccattgttcaaaggtaaacgtgttgctgta
attggtggtggtaactcaggtgtagaagctgcaattgatcttgcagggattgttgaacat
gtaaccttggttgagttcgacaccaaacttcgagcggatcaagtgttacaagataagtta
aacagcttatctaatacaacagtgatcatgaatgcattgagcactgaagtgcttggtgat
ggttcacaagtgacaggcttgaagtataaagatcgtgctacagatcaaaaacatgtggtt
gagcttgcagggatctttgttcaaattggtttattaccgaatacagatttcttgaaagac
agcgctgttgaattaagcaatcgtggtgagatcatggtgaatgatcgcaatgaaaccaat
gtgaaaggtgtctttgctgcaggagactgtactacagtgccttataagcaaatcatcatt
gccacaggtgaaggcgcgaaagcttcgctctctgcttttgattatatgattcgttctggc
gtttaa

DBGET integrated database retrieval system