KEGG   Acinetobacter haemolyticus: AHTJS_10155Help
Entry
AHTJS_10155       CDS       T04618                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ahl  Acinetobacter haemolyticus
Brite
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AHTJS_10155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: APR70702
UniProt: A0A1L6KNQ3
LinkDB All DBs
Position
2072651..2073277
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHITRETLEYHHDKHHNTYVVNLNNLIKGTDLEGKSLEEIIKA
SAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTANADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLESLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgacttagcaccacatatc
acacgtgaaactttagaatatcaccatgataaacatcataatacttatgttgttaactta
aataacctaatcaaaggtactgaccttgaaggtaaatctttagaagaaatcatcaaagca
tctgctggtgatgcatctaaagcaggtatcttcaacaatgctgcacaagtatggaaccat
acattctactggaacagcatgaagccaaatggtggtggtaaaccaactggcgcgattgca
gctaaaatcgatgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaatttggttcaggttgggcttggttagtagctgatgaagtaaatggtaaa
ttatcaattactaaaactgccaatgcagacacaccacttgctcatggtcaaattgcagta
ttgacgattgatgtttgggaacatgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaagcttagtgaactgggactatgcaaatgcaaaacttgca
ggtcaaccagcaggtgttgagaaataa

DBGET integrated database retrieval system