KEGG   Acinetobacter haemolyticus: AHTJS_11795Help
Entry
AHTJS_11795       CDS       T04618                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00730  Thiamine metabolism
ahl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AHTJS_11795
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     AHTJS_11795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like GIDA NAD_binding_8 NAD_binding_9 Thi4 Pyr_redox_2 Pyr_redox_3 FAD_binding_3 Helicase_IV_N Amino_oxidase Pyr_redox ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APR70977
UniProt: A0A1L6KPG0
LinkDB All DBs
Position
2405082..2406215
Genome map
AA seq 377 aa AA seqDB search
MHIAIIGAGISGLMTALELVEQGCSVDIFDQQQAGQAASWAGGGILSPMYPWRYAPEVNQ
LAKYGKSLYQSWNEKLSPITGIDFQIHDTGMLIFDKGDFQIGLEYAEKYNEPMQRCEYLT
GDDIQQVNQHISADFKQAIYFPELSNVRNPRLLQSLIHYLKQHPCVRFFEHCTVEKLIIK
NKTVHGIETEDHQQYFADQVVLTSGAWSNYWQQQVQRKIPVHPVQGQMLLFKTPENWLPT
MCMNRVMYLIPRQDGHIVCGSSMSECGFSTAVDAKTQQDILSACLEMVPELAQFPIVKRW
AGLRPSSPHGIPYIGAMPEINRLWANFGHFRNGLCMGAGSAKLLAQLMLNQKTFVDPHAY
SPDRLACTQSAIHENLS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgccatcattggtgcaggaattagcggcttaatgactgcacttgagctcgtt
gaacaaggctgctccgtcgatatttttgatcaacaacaagctggtcaagccgcttcgtgg
gcgggtggcggtatcctctctccgatgtatccatggcgatatgcacctgaagtgaatcaa
cttgccaaatatggcaaatcactctatcaatcatggaatgaaaaactgtccccgatcaca
ggtatcgattttcaaattcacgatacaggtatgttgatttttgataagggtgacttccaa
ataggcttggaatatgctgaaaaatataatgagccgatgcaacgttgtgaatacttaaca
ggcgatgacatacaacaggtaaatcagcatatctctgcggacttcaaacaagcaatctat
ttccctgagctttcaaatgttcgcaatcctcgcctattacaatctttgattcattattta
aaacaacatccttgcgttcgcttttttgaacattgtaccgtcgagaagctgatcattaaa
aataaaaccgttcacggtatagaaactgaagatcatcaacaatattttgctgatcaggtg
gtactcacttcaggtgcatggagcaattattggcaacaacaagttcagcgaaagattcct
gtacatcccgtccaaggtcagatgctactgtttaaaacccctgaaaactggcttcccacc
atgtgtatgaatcgcgtcatgtatctgattccacgtcaagatggccatattgtctgtgga
tcaagtatgtctgaatgcggatttagtacagccgtcgatgcaaaaacccaacaagatatt
ttatctgcttgtttagaaatggtaccagagttagcacaattcccgatcgtaaaacgctgg
gctggtttacgtccaagttcgccacatggtattccctatatcggtgcaatgcctgaaatt
aatcgtctttgggcaaatttcgggcatttccgcaatgggctgtgtatgggggcaggatca
gcaaaactcttggcgcagctcatgttaaaccaaaaaacttttgttgatccacacgcctac
tcacctgaccgattggcatgtactcaatcagcgatccatgagaatctgagttaa

DBGET integrated database retrieval system