KEGG   Acinetobacter haemolyticus: AHTJS_13125Help
Entry
AHTJS_13125       CDS       T04618                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ahl  Acinetobacter haemolyticus
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AHTJS_13125
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AHTJS_13125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: APR71205
UniProt: A0A1L6KQ45
LinkDB All DBs
Position
complement(2681237..2681857)
Genome map
AA seq 206 aa AA seqDB search
MIDLYYWGTPNGHKITIALEEMGLEYQIFPINILENDQFQPDFLRISPNNKIPAIVDQNG
PRGEPISVFESGAILQYLGRKTGLFYPVDEQERVEVEQWLMWQMGGFGPMLGQNHHFNKF
APERIPYATERYINETKRLYGVLDKQLVGQKFVAGEYSIADMAILPWALRYEWQSIQLED
YPYVKDYIDRLTARPAIQRALSIKVG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgacttatattattggggtacgcccaatggccataaaataacgattgctttagaa
gaaatggggcttgaatatcaaattttcccgattaatattttagaaaatgatcagtttcag
ccagactttttaaggatttctccaaacaataaaattccagcaatcgttgatcaaaatggt
ccacgtggtgaaccaatttctgtatttgaatctggcgcaatcttgcaatatttaggtcgc
aaaactggattgttctatcccgttgatgagcaagagcgagttgaggtagagcaatggttg
atgtggcaaatgggtggttttggtccgatgcttgggcaaaaccatcatttcaacaagttt
gcacctgagcgtattccttatgcgacggagcgctatatcaatgaaaccaaacggctgtat
ggtgttttggataaacagctggttggtcagaagtttgtagctggtgaatactcgatcgca
gatatggcgattttaccttgggcattacgctatgagtggcaaagtattcaactcgaagat
tatccttatgtgaaagattatatcgatcgcttaactgcacgtcctgccatacaaagagct
ttatcgatcaaagtaggataa

DBGET integrated database retrieval system