KEGG   Actinoalloteichus hymeniacidonis: TL08_11230Help
Entry
TL08_11230        CDS       T04472                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00010  Glycolysis / Gluconeogenesis
ahm00020  Citrate cycle (TCA cycle)
ahm00620  Pyruvate metabolism
ahm01100  Metabolic pathways
ahm01110  Biosynthesis of secondary metabolites
ahm01120  Microbial metabolism in diverse environments
ahm01130  Biosynthesis of antibiotics
ahm01200  Carbon metabolism
Module
ahm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TL08_11230
   00020 Citrate cycle (TCA cycle)
    TL08_11230
   00620 Pyruvate metabolism
    TL08_11230
Enzymes [BR:ahm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TL08_11230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3597 HlyD_3 Biotin_lipoyl_2 GCV_H HlyD_2
Motif
Other DBs
NCBI-ProteinID: AOS63060
UniProt: A0A1D8BW85
LinkDB All DBs
Position
complement(2431041..2432330)
Genome map
AA seq 429 aa AA seqDB search
MTEIQMPRLSDTMEEGVISSWLKQEGDKISRGDVVAEIETDKAVMELEAYDDGVLEKILV
PAGELVPIGAAIGLLGDGSESASASAPAAPAEQPAAAETVEEPAAQREPAQADAAAESDS
AAGPASRPRSSPLARKIARDAGVDLDTVTGSGPRGRIVRADVDAAVAAKRSAEAEPTESK
PAPTQAAKPAAVTAAAEDVEEIPLSNIRRVAAKRLTESKQQAPHFYLTSAVDVTELLTFR
ADLTARVQAAGGPKISINDLLVKAVATALRANPTVNVSFAGDKILQHKRIHLGIAVAIDS
GLVVPVLRDADRKSVSELSGEAREKAGRAREGKLKSDEMTGGTFTISNLGMFGIEEFAAV
INPPEAAILAVGAVRDELRLREDGKNKVEVRKILRITLSADHRAIDGAVGAVFLQQLTAL
LEDPIRIIA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgagattcagatgccacggctctccgacaccatggaggagggcgtgatctcctct
tggttgaaacaggagggcgacaagatcagcagaggcgacgtggtcgccgagatcgagacc
gacaaggccgtcatggagctggaggcctacgacgacggcgtgttggagaagatcctggta
cccgccggtgagctggtaccgatcggtgcggcgatcggcctgctcggcgacggttccgag
tcggcttcggcctcggccccggccgcgcccgccgagcagcctgccgccgccgagaccgtc
gaggagcccgccgcgcagcgggaaccggctcaggccgacgctgctgcggagtccgactcc
gcagccggtcccgcctcccggccccggtcctccccgctggccaggaagatcgcccgggac
gcgggcgtcgacctggacaccgtgacgggcagcgggccgcgtggacggatcgtccgtgcc
gacgtggacgccgcagtggcggcgaagcgctccgccgaggccgagcccaccgagtcgaag
cccgcgccgacgcaggccgcgaagcccgccgccgtcacggccgccgccgaggacgtcgag
gagatcccgctcagcaacatccggcgggtggccgccaagcggctgaccgagagcaaacag
caggcgccgcacttctacctcaccagcgcggtggacgtcacggagctgctgaccttccgc
gccgacctcaccgcccgagtgcaggcggcgggcggcccgaagatcagcatcaacgacctg
ctggtcaaggcggtcgccaccgcgctgcgggcgaacccgacggtgaacgtctccttcgcg
ggcgacaagatcctgcagcacaagcggatccacctggggatcgccgtggccatcgactcc
ggcctggtggtcccggtgctgcgcgacgccgaccgcaagagcgtgtccgagctctccggc
gaggccagggagaaggcgggtcgcgccagggagggcaagctcaagagcgacgagatgacc
ggtggcaccttcaccatctccaacctcggcatgttcggcatcgaggagttcgcggcggtg
atcaacccgccggaggccgcgatcctggccgtcggggcggtccgcgacgagcttcggctg
cgcgaggacggcaagaacaaggtcgaggtgcgcaagatcctgcggatcacgctgtcggcc
gatcaccgcgccatcgacggcgcggtgggtgccgtgttcctgcagcagctgaccgcgctg
ctcgaggacccgatccgcatcatcgcctga

DBGET integrated database retrieval system