KEGG   Actinoalloteichus hymeniacidonis: TL08_11945Help
Entry
TL08_11945        CDS       T04472                                 

Definition
(GenBank) BNR repeat-like domain
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00511  Other glycan degradation
ahm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    TL08_11945
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TL08_11945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ahm02042]
    TL08_11945
Enzymes [BR:ahm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TL08_11945
Bacterial toxins [BR:ahm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TL08_11945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-ProteinID: AOS63203
UniProt: A0A1D8BWL9
LinkDB All DBs
Position
2591268..2592485
Genome map
AA seq 405 aa AA seqDB search
MRAFPRAATTLLAAALLFCATGLPASADPGSARPGSERPGRPYSPTEVYVSGTEGYDTFR
IPAIIRASNGDLLAFAEGRRDGGGDSGDIDLVLKRSTNDGRTWGALTVVGDNGPNTFGNP
SPVVDPATGRIVLLSTHNGGTVTEHEIRAGEVDPADSRRVWVQHSEDDGRTWTEPREITE
DTKLPEWRWYATGPVHAIALSRGQHAGRLVVPANHSSAPPEGSPDTGIEDRYYDAHLIYS
DDGGLNWTIGAMEDTPDGAVNGNETTIAELPDGRIYVNSRNQNGTAPGNRLATYSSDGGA
GFDEPLQPVPDLLTPVVQGSVLQIEDGPLLLAAPSNPDRRERLAVRSSHDDGASWSDGVV
LSEAPAAYSDLVPLHRGGVGVYYETGVDSSYETISFQRLSARDLR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctttccacgagccgccacgacactgctcgccgccgcattgctgttctgcgca
acgggtctcccggcctcggcggatccgggcagcgcccgcccgggctcggagcggcccggc
cgcccgtactcgccgaccgaggtctacgtctcgggcaccgaggggtacgacaccttccgc
atcccggcgatcatccgcgcgtccaacggcgacctgctcgccttcgccgaggggcgccgg
gacggcggtggcgacagcggcgacatcgacttggtgctcaagcggtccacgaacgacggc
aggacctggggagcgctcacggtggtcggcgacaacggccccaacaccttcggcaatccc
agcccggtggtggatccggccaccggtcgaatcgtgctgctgtcgacccacaacggcggg
acggtcaccgagcacgagatccgcgccggagaggtcgaccccgccgactccagacgggtg
tgggtgcagcacagcgaggacgacggccggacctggaccgagccccgggagatcaccgag
gacaccaaactgccggaatggcgttggtatgcgacaggtccggtgcacgccatcgcactg
agtcgagggcagcacgctggacgtctggtggtgcccgccaatcactccagtgcgccgccg
gaggggagcccggacaccgggatcgaggaccgttactacgacgcccacctgatctacagc
gacgacggcgggctgaactggaccatcggggcgatggaggacaccccggacggcgccgtc
aacggcaacgagacgacgatcgcggagctgccggacggtcgaatctacgtcaactcccgg
aatcagaacgggactgcgccgggaaaccgcctcgccacctacagcagcgatggcggcgca
ggcttcgacgagccactgcagccggtgccggacctcctcaccccggtcgtgcagggcagc
gtcctgcagatcgaggacggtccgctgctgttggccgccccgagcaatcccgaccgacgc
gaacgcctcgccgtgcgctccagccacgacgacggggcgagctggtcggacggtgtcgtg
ttgtccgaggcgcctgcggcctactccgatctggtgccgctgcaccggggcggcgtcggc
gtctactacgagaccggagtcgactcctcctacgagacgatctccttccaacggctgtcc
gcgcgcgatctccgatga

DBGET integrated database retrieval system