KEGG   Actinoalloteichus hymeniacidonis: TL08_12310Help
Entry
TL08_12310        CDS       T04472                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00380  Tryptophan metabolism
ahm00630  Glyoxylate and dicarboxylate metabolism
ahm01110  Biosynthesis of secondary metabolites
ahm01130  Biosynthesis of antibiotics
ahm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TL08_12310
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    TL08_12310
Enzymes [BR:ahm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     TL08_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AOS63276
UniProt: A0A1D8BWY2
LinkDB All DBs
Position
complement(2670059..2672200)
Genome map
AA seq 713 aa AA seqDB search
MANTSGPGEQTHGGDEKDQDLASARVDPAGSRLTTAQGLRVEHTDDSLRAGERGPTLLED
FHAREKLTHFDHERIPERVVHARGSGAYGYFQPYNDVLAQYTVAEFLRDPARRTPVFVRF
STVAGSRGSADTVRDVRGFATKFYTRQGNYDLVGNNMPVFFIQDGIKFPDFVHAVKPEPD
NEMPQAASAHDTFWDFVGMQPESLHMAMWLMSDRALPRSFRMMQGFGVHTFRLVDASGVG
TFVKFHWTPRLGTHSLIWDECQRIAGKDPDFLRRDLWNAIASGDYPEWELGVQLVSESDE
FAFDFDLLDATKLIPEELVPVQPVGRMVLTRNPQNFFAETEQVAFHTANLVPGIDFTNDP
LLQARNFSYLDTQLIRLGGPNFSQLPVNRPIVPVHDNQRDGYAQQCIHLGRAPYHKNSID
AGYPMVSSASEGGYTHYQERVDGHKIRSRSGSFADHHSQATLFWNSMAEWEREHIVAAFH
FELGKVDRLEIRERVVAHLDHISRELAERVAPGIGVTVPSGPAPTTHSRTSPALSQEGTV
TDIVRGRSVAVLAADGVHGESLRSLTSALSEFGLLVEVLAPHAGPLRAVGGGQASADRAM
PTMSSVLYDAVLVADGEESAANLRADGLAVHFVAEAVKHAKAVAAVGAGVEVLRAAPLAG
FRFAEPGEDLVSDQGVLTSGSSPDVPPTRFLTAFAGAIAAHRTWTRAVDSIPA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacctcgggaccgggcgagcagacccatggcggggacgagaaggatcaggat
ctcgcctcggcacgggtggacccggccgggagcaggctcaccacggcgcaggggctgcgg
gtcgagcacaccgacgactcgctgcgggccggtgaacgaggtccgaccctgctggaggac
ttccatgcccgagagaagctcacgcacttcgatcacgaacgcatccccgagcgggtcgtg
catgccagggggtccggcgcctacggctacttccagccctacaacgacgtcctagcccag
tacacggtcgccgagttcctccgggacccggcgcggcgcaccccggtgttcgtccggttc
tccacggtggccggctcgcggggctcggcggacaccgtccgcgatgtccgagggttcgcc
accaagttctacacccgtcagggcaactacgacctggtcggcaacaacatgccggtgttc
ttcatccaggacggcatcaagttcccggacttcgtgcacgcggtgaaaccggagccggac
aacgagatgccgcaggcggcctcggcgcacgacacgttctgggacttcgtcggcatgcag
cccgaatcgctgcacatggcgatgtggctgatgtccgaccgggcactgccacgcagcttc
cgcatgatgcagggattcggggtccacaccttccgtctggtcgatgcctccggggtgggc
accttcgtgaagttccactggacgccgaggctcggcacccattccctgatctgggatgaa
tgccagcgaatcgctggaaaggatcctgatttcctgcgccgcgacctctggaacgcgatc
gcttcgggcgactatccggaatgggaactcggtgtgcaactcgtctcggagtccgacgag
ttcgccttcgacttcgatctcctggacgcgaccaaactcattcccgaggaactcgtcccg
gtacagccggtcgggcgaatggtgttgacccggaatccgcagaacttcttcgccgagacc
gagcaggtcgccttccacacggccaatctggtgcccggcatcgatttcaccaatgatccg
ttgttgcaggctcgcaacttctcctatctggacacccagttgatccgactgggcggcccg
aacttcagtcagctaccggtgaaccgcccgatcgtcccggtgcacgacaaccagcgggac
ggctatgcacagcaatgtattcatctcgggcgcgccccgtaccacaagaacagcatcgac
gcgggctacccgatggtctccagcgcgagcgagggcgggtacacccattatcaggagcgg
gtcgacggccataagatccgcagccgcagtgggagtttcgccgaccaccacagccaggcg
acgttgttctggaacagcatggcggagtgggaacgcgagcacatcgtcgcggccttccat
ttcgagttgggcaaggtcgaccggctcgagatccgcgaacgagtcgtcgcgcatctggat
cacatctcccgggagctggccgaacgggtagcgccgggcatcggcgtcacggtgccgtcc
gggccggcaccgaccacgcactcccgcacgtcaccggcgttgagccaggagggcaccgtc
accgacatcgtccgaggccgcagcgtcgccgtgctggcggccgacggggtgcacggtgaa
tcgctgcgttcgctgacctcggcactgtccgagttcgggctgctggtcgaggtactggcg
ccccacgcgggtccgctgcgcgcggtgggcggcggacaggcgagcgccgaccgggccatg
cccaccatgtcgtcggtgctctacgacgctgtgctggtcgccgacggggaggagtcggcg
gcgaacctgcgtgccgacgggctggccgtgcacttcgtcgcggaagccgtcaaacacgcc
aaggccgtcgcggccgtgggcgcgggcgtcgaggtcctgcgggccgccccgctggcgggt
ttccgattcgccgaacccggcgaggacctcgtctcggaccagggcgtgctcaccagcggg
tcctcccccgacgtgcccccgacccgcttcctcaccgccttcgcgggcgcgatcgccgcc
catcgcacctggactcgggccgtcgactcgatcccggcctga

DBGET integrated database retrieval system