KEGG   Actinoalloteichus hymeniacidonis: TL08_15990Help
Entry
TL08_15990        CDS       T04472                                 

Definition
(GenBank) polyketide synthase family protein
Organism
ahm  Actinoalloteichus hymeniacidonis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase adh_short_C2 GDP_Man_Dehyd Polysacc_synt_2 PKS_DE SAT NmrA RmlD_sub_bind ACP_syn_III NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AOS63998
UniProt: A0A1D8BYW9
LinkDB All DBs
Position
complement(3704035..3721779)
Genome map
AA seq 5914 aa AA seqDB search
MSQNDTDRRLAIVGLSCRLPGADSPDALWELLTEGRCTISEVPASRWTGEDGPEAAGSRW
GSFLDDVEGFDPAFFGISPREAAAMDPQQRLALELGWEAVEHAGIVPAALEGSRTGVFFA
AMHDDYAVLARRQGDGVTGQHTFTGLQRSMLANRVSYFFGARGPSLTVDTGQSSSLVAVH
LAAESLRSGESDLAVAGGVNLILAAESSLVAARFGALSPDGRCRTFDAAANGFVRGEGGG
AIVLKRIADAIADGDHVYALVDGTAVNNDGGGDGLTAPNELAQREVLRLAYERSGVSLDE
VGYVELHGTGTPVGDVVEAAALGAVLGAARTGTPLPVGSVKTNVGHLEAAAGIVGVLKTV
LAIEHGKLPRSLGFDAPNPRIPLEELGLRVNTEVSPWLPADRPPVAGVSAFGMGGTNCHV
VLLGPSGSMRAAQPFGGTTHLGLVEPAGSEPADQPGTSGGTTHHVVSGRTAEALRAQAGR
LRDVVDAGANLVDLEFSLAATRAAFEHRAVVSADDRDALREGLDALATGRRVPGVVEGSV
GAGGKVAFLFSGQGSQHPGTGSELYAASPVFAEALDAVCAEFDRLLEQPLRPIMFAVAGT
SAADLLNRTEYTQPALFALQVALYRVTERVGLRPDLLAGHSIGGITAAHLSGVLSLPDAC
VLVAARGRLMQALPEGGAMVAVQAAEADVLPLLTGRDGEVSVAAVNGPAATVLSGDEQAV
LDVAAELARRGHKTRRLRVSHAFHSPRMEPMLAEFREVLAGLDLREPGIPLVSDLTGALA
TAEELRTADYWVRHVREPVRFLDVVSELAGLGVTRFLELGPDGTLSTAAADGPASGAFRT
PVLRPDRAEMRSLTSALAGLHVRGVTVDWPAFTGHGGHRITLPGYPFQRTRHWLTDQPAS
APHAAAVQSDTASAPHAAAVQSDTGQEDVLGTVLACTALVMDAVGTTGIDPDRSFRDLGF
SSLMTVELRDELVTVTGVALPRTVLFDHTSPRAVADHLREALAGTPRPVDEGSDKAHPGE
PIAIVGMGCRLPGGVRTPEALWELLSAGTDAISGFPDDRGWDLDGLYDPEPGTTGKAYTR
AGGFIDAADFDPEFFGISPREATAMDPQQRLLLETAWEALEDGAVDPATLRGSQAGIFVG
VTAQEYGPRLADASGGHEGYALTGTSVSLASGRIAYVLGSQGPAVTVDTACSSSLVALHL
AVQSLRQGESSLALAGGAAIMPGPGMFVEFAQQRGLSPDGRCRSFGADADGTGWAEGVGM
LALERLSDARARGHEVLAVIRGTAVNSDGASNGLTAPNGLAQQRVIRLALADAGMTGGEV
DAVEAHGTGTPLGDPIEAGALQATYGSDRDADRPLLLGSVKSNIGHTQAAAGVAGVIKMV
LAMRHGVLPRTLHAEVPTPEVEWSSGAISLLTEEIPWPGTGPRRAAVSSFGISGTNAHAV
LEHAPTSTEPGSEPADGPVPWLLSAPTPQGITRQAARLRDHLEAHPDLVPADVALSLATT
RTTFPHRAAVVAAGDDLLRGLERLAAGENTGRGTASDGGVAFLFTGQGSQRAGMGRELYE
RFPIFAAAFDAVCAELEPGLRELVFGADGDGLLERTVHAQPALFAIEVALFRLLESWGVV
PDLLLGHSIGEVAAAHVAGVLSLPDACTLVAARGRFMQAATTGGAMAAVQATEQELAEDL
DASAGLVALAAVNGPNSVVVSGDSEAVEAITARWRDQGRKTSRLRVSHAFHSPHMDSVLA
GFAEVVGALPLAEPRIPIVSNRTGRIAEVGELTSPDYWVRQVREPVRFLDGVRHLVASGT
TTYLELGPDATLSGMVRDCLGDEAVGVAVLPMMRKDRPESATALTALAAAHGHGVVVDWR
AVLPAARTVRLPTYAFERGRFWLDQPTSTGDARGLGQGMTGHPMLGATVSLADGNGTVFT
GRLSLRTHPWLGDHVIAGQVLLPASAFVELALRAGQEAGCDEVAELTLEAPLVLPAEDGV
RLQVAIDAPDAAGHRRLTVYSGDERVDGWTRHATGLLSSARGPAGAPAPRPAGVLAEPDD
VYSRLDALGYRYGPVFQALQRVGASGADLFAEVSLPSGTRADDVRGFGIHPALLDAVLHP
LVLAAAEEDGELRLPFAWSGVRLYATGATWLRVRATRTGPETYSLLATDADDRPVVGVAS
LVLRPVPVERIAQAAAPGNGNLYRPTLVPIPLAVQPADVIDTVVWVEPGTPAEVTARALR
SAREWLAQPGTAGRLAFVTRAAVHAPAGPDLAGAALWGLVRSAQTENPRRFALVDLDDSS
EHLLASALSAGEDRLVLRDGQAYAPRLHRARPELEDVPTVLDSHGTVLITGGTGVLGGIF
ARHLVTAHGVRHLLLVSRSGPAAPGAADLAAALESLGAEVRIEACDAADAKALDELLATV
PASHPLTGVIHAAGVLDDAPIETLDPDRLAVVLRAKADAAWNLHRATAGTDLAAFVMFSS
IAGHIGSAGQGAYAAANRYLDALAEQRRAAGLPAVSLAWGLWDLDTGMAGGLGPAERARW
ARGGVTPLPVRSGLELFDLALGGGADAILVPVTLALAGVTALPDEFRDLVRAPLHRATAP
AAGGSSWAARTAALPALEREREIRALVRSAVAAVLGHDGSTPADPDRTFREIGFDSLTGI
ELRNHLHAATGIRISTTATFDHPTPTRLADHLVEQLTGARSAEPSVVRAADSDDPIAVIG
MACGYPGGVRGPEDLWRLVSEGVDAIGDFPGDRGWDVDGLYDPDPDRIGTSITREGGFLH
SAADFDPEFFGISPREALAVDPQQRLLLEASWEAVERAGIDPVSLRGSRTGVYAGMMYHD
YASRLPVAPDGFEGRLLTGNTGSVASGRVSYTLGLEGPAVTVDTACSSSLVAMHLAAQAL
RSGECSLALAGGVTVMSTPNTFVEFSRQRGLAPDGRCRAYAEDAAGTGWAEGVGVLLLER
LSDARRNGHPVLAVVRGTATNQDGASNGLTAPNGPAQERVIRQALANAGLTTADVDAVEG
HGTGTRLGDPIEVRALMATYGQDRPEDRPLWLGSLKSNIGHSQAAAGVGGVIKMIMAMRH
GVLPRTLHADTPSTRIDWSAGAVSLLADAVPWPEADRPRRAAVSSFGISGTNAHVVLEAH
EVTAAEPVPPAPPVVPLPLSARTDAALRAQAGRLSPFVTELPLAGLAATMAGRSIMDHRA
VVLGTDRDELRAGLNAVARDDQTATDLQVVRGVAVARGATVFVFPGQGSQWQGMALDLLG
SSPVFAERLTECAAALERHVDWSVLGVLRGEPGSADIERVDVVQPLLFAVMVSLAEMWRS
SGAEPAAVVGHSQGEIAAACVAGALSLDDAARVVALRSRALVALAGGGGMVSLPLNVEEA
EARIAEWAGQLSIAAVNGPRSVVVSGDAAALDALMSACDADGVRARRIPVDYASHSAHVE
AIEARLATDLAGLSPRPAAVPFYSTVTAGEPDTSALDGGYWYRNLRQTVRLDETVRLLLD
RGHRMFIEVSPHPVLTIGVAETVEDTGLQDETVVIGTLRRDQGSLRRFLASAAEAYVGGL
LIDWRRLSGVVGAPHVELPTYPFQRSRYWLDASLTRSGAGTGLTVLDHPVLAGTVVVADG
ETELFTGELGLATQPWLADHRVGGKTLVPGTAFLDLVATAAAHADCAVVEDLTLETPMLV
PSTGTVRLQLLVGAADSTGRRAVSLHSRSGGEPHWQCHATGTLAPATSQAPPAGGTWPPR
DAIAIDLDDAYARLADRGLHYGPAFQGLHAAWRDGEHTYAEIRLPESVAAGGFGLHPALF
DAALHPLALDHDGGHGTVPLPFTWRGVSLYRTDATVLRVRLTSDDTGTAIVAHDAAGAPV
LQAESLVLRSARLDGVGGAPLYRLDWVPVPPMDEPGTDGWEGEVAVLGVEADGDVVARTH
RATQAALNLVQARLATNESGLLVVTSTAVAVSPDETPDPAAAAVLGLIRTAQTEHPDSFL
LLDLPAGEEPTAELLAAARASGEPQLAARGGKLYAPRLAALPNGTGTTDWEPDGTVLITG
GTGVLGATLARHLVTRHGVRNLILASRRGPAAKGAEALVAELTAAGARVTLAACDAADRT
ALAALLAAVPAEHPLTAVVHTAGVLADHTVENLDPDRLAAVLRPKVDGAWHLHELTRDLA
PQLAGFVVFSSFAGTLGTAGQANYAAANAFVDALAQHRTTAGLPATSLAWGLWAEGTGMT
GHLGTAALAGLAGSGIAAIDTDQGLAMFDTAVAGGLAVTVPALLDLSALRTQATEGTLPP
IFRNLVRGVRRRATAIARTGETPEERKNRLLDLTTGSVAAVLGHASPETIDIRRPFTELG
FDSLLAVQLRNRLKAATGLGLSATIVFDHPTVQALAAHLDAQLDGGTAAETGDAPARAGT
DEPIAIVAMACRFPGGVSTPEDLWQLVADGVDTTSEFPGNRGWNTADLYDPDPDSTGRTY
ARAGSFLHDAGDFDADFFGISPNEALAVDPQQRLLLETAWEAFERAGIDPNSLRGSDTGV
FAGIMLHDYAPSAGGPANLEGKLAVANAPSVASGRVSYTFGLQGPAITVDTACSSSLVSL
HLAAQSLRQGECSLALAGGATVMATPELFVEFSRQRGLSADGRCKSFAGAADGTGWGEGA
GWLLLERLSDARRLGHEVLAVVRGSAVNQDGASNGLTAPNGPAQQRVIRQALASARLTAA
DVDVVEAHGTGTRLGDPIEAQALLATYGQDRDEPLLLGSVKSNIGHTQAAAGVAGVIKMV
LALRHGVVPRTLHVDEPTPEVDWSAGAVELATSQVSWPTVDRVRRAAVSSFGVSGTNAHV
VLEQAPTVDAPVGNRPSGVVPWTLSAKTDAALRAQAARLRAFVQAHSDLDPADVGWSLAT
GRSVFDRRAVVVGGDRDALLDGLTALASGGPVVGVGTGRAVFVFPGQGSQWVGMAVGLMD
SSPVFAASMDECGSALSEFVEWSVVDVLRAGGELERVDVVQPVLWAVMVSLAALWRSFGV
EPVAVVGHSQGEIAAAVVAGALSLRDGARVVALRSRVLLGIAGDGGMVSVALSVDEVRAR
LVDGIGVAAVNGPGSVVVSGAAGVLDRWQAEVEAAGVRVRRIPVDYASHSVDVERLRDEI
LKVLAPVTPRSVELPFYSTLTGGVLDTSGLNAEYWYESLRRPVLFEQATRQLLEDGHDLL
IESSPHPVLAVGIEETIEAAGSKAAVVGSLRRDDGGLDRFLASLGEAWTRGATPDWSAVL
AGGRRVELPTYAFQRVRFWLENRPATAPVDALFWDLVDQGEVDAMVSGVGPEAEQERSAL
TTVLPMLATWRRRQQEETFRYRVTWVPVPENPVEPGPWLVLVPEEPTEHVAGCLDALNAL
GSKIMPIDPRSGLGDLSGPEPRGVLSLLALGGKTALENAADLARVTRELGEAGVGAPLWV
ATSGATGPGVPHAPEQAMLWGLGRSAAVEIPDRWGGLIDIPAEPTPETWRHFAGALGGDE
DQVAVRASGVLARRLVRSTGPSKGWQPRGTVLVTGGTGAVGREVARWLATQGVERLVLTS
RSGGNAPEAGPLAAELAAVGVSVAVESCDVADRQALAVLLERHTPNAIIHAAGALDDGLV
GSLTAARFTAIAASKVDAVKNLYELTRDTGLDAFVAFTSLAGVVGSPGQGNYAAANAAVD
ALIETYRVQGFPATSIAWGLWAGSGADDGTSGRHLGARGIVPVEPARMLDSLGWAVGNDE
ASTTVARIDWPRFTLLSAATRLYDDLVDTRRQADEPAAQEAEATSLADRLALLPPAERNR
EVIALVRREAAVALGHADAELIESGRAFRELGFDSLTAMQLRNRLVAVTGLDLPSALVFN
YPNTTALAEHLLSRLIPDTGADHDGVLGILDRLDSALAHAVDGDVLREVSGRLEALLARW
RERDTSSDSVLEEDAIESVSDDEIFRLIDQNFDL
NT seq 17745 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaacgacaccgatcgcaggctcgcgatcgtcggactgtcctgccggctgccg
ggtgcggattccccggacgccctgtgggagctgctcaccgagggccgttgcacgatctcg
gaagtaccggcgtcgcgctggaccggcgaagacggaccggaggccgccggttcgcgctgg
ggctcgttcctggacgacgtcgaaggcttcgatccggccttcttcggcatctcgccgcgc
gaggccgccgcgatggacccgcagcaacgcctggccctggaactgggctgggaggccgtc
gagcacgcgggaatcgtcccggccgcgctggagggctcgcgcaccggcgtgttcttcgcc
gctatgcacgacgactacgccgtactcgcccgacgccagggtgacggggtgaccggccag
cacaccttcaccgggttgcagcgcagcatgctggccaaccgggtgtcgtacttcttcggc
gcgcgtggcccgagtctgaccgtcgacaccgggcaatcgtcgtcgctggtggccgtgcac
ctcgcagccgagagcctgcggtccggtgagtccgacctcgcggtcgcgggtggggtcaac
ctgatcctggccgcagagagctcgctcgtggcggcccggttcggtgcgctctccccggac
ggtcgctgccggaccttcgacgccgcggccaacggcttcgtccgaggtgagggcggcggc
gccatcgttctgaagcggatcgccgacgcgatcgccgacggcgaccacgtgtacgcgctg
gtcgacgggaccgcggtcaacaacgacggcggtggcgacgggctgaccgcgcccaacgaa
ctcgcacagcgtgaggtgctgcggctcgcttacgagcgctccggtgtctccctcgacgag
gtcggctacgtcgaactgcacggcaccgggaccccggtcggtgacgttgtcgaggcggcg
gccctgggcgcggtgctgggtgcggctcgcaccgggacgccgctgcccgtcggctcggtc
aagaccaacgtgggacacctggaagccgcagccgggatcgtcggcgtgctgaagacggtg
ctggcgatcgagcacgggaaactgccccgaagcctcggcttcgatgccccgaacccgcga
atccctcttgaagagctgggtttgcgggtcaacaccgaggtgagcccgtggctgcccgcc
gaccggccgccggtcgccggggtcagcgctttcggcatgggcggcacgaactgccacgtc
gtgctcctcgggccgtcgggttccatgcgggcggctcagccgttcggcgggaccacgcac
ctcgggcttgtagagccggctggctccgagccagcggatcagccgggtacgtccggcggg
accacgcaccacgtggtgtcggggcgtacggccgaggctctgcgggcgcaggccgggcgg
ctgcgggacgtcgtcgacgccggagcgaacctggtcgacctggagttctccctcgcggcg
acccgtgcggcgttcgaacaccgtgcagtggtgtccgccgatgatcgggacgcgctgcgg
gaagggctcgacgcactggcgacgggccgtcgtgttcccggagttgtcgaggggtccgtc
ggtgccggtggcaaggtggcgttcctcttctccggtcagggcagccagcatccggggacc
ggcagcgagctgtacgccgcgtcccccgtgttcgccgaggcactcgacgccgtgtgcgcg
gagttcgaccgcctgctcgaacagccgttgcgccccatcatgttcgctgtcgcgggaacg
tccgccgcagacctgctgaaccgcaccgagtacacgcagccagcccttttcgcccttcag
gtcgccctgtaccgggtgaccgaacgggtggggctgcgaccggacttgctggccgggcat
tcgatcggcggcatcaccgccgcccacctgtccggtgtgctgtcgctacccgacgcctgt
gttctcgtcgccgcgcgcggccggttgatgcaggcgctgccggagggcggggcgatggtc
gccgtccaggcggctgaggcggacgtgctgccgctgctgaccggccgggacggcgaggtg
tccgtggccgccgtgaacggaccggccgccaccgtgctctcgggcgatgagcaggcagtt
ctggacgtcgccgccgaactggcccggcgcggccacaagacgcggcggttgcgggtgagc
catgccttccactcgcctcggatggagccgatgctggccgagttccgggaggttctggcc
gggctcgacctgagggaaccgggtatcccgctggtctcggacctgaccggcgcgctcgcc
accgccgaggagttgcgcacggctgactactgggtgcggcacgtgcgggaaccggtgcga
ttcctggacgtcgtaagcgaactcgcgggactcggcgtcacgaggttcctggaactcggt
ccggacgggacgctgagcaccgcggcggccgacggcccggcatccggggccttccgcacc
cccgtgttgcggcccgaccgggccgagatgcgctccttgacctcggcgctggccgggttg
cacgtccgcggtgtcacagtggactggcccgcgttcaccgggcacggcggacaccggatc
accctgcccggatacccgttccagcgcacgcgccactggctcaccgaccagcctgcctcg
gcaccgcacgcggctgcggtccagtcggacaccgcctcggcaccgcacgcggctgcggtc
cagtcggacaccggccaggaggacgtgctcggcacggttctggcctgcacggctctggtg
atggacgcggtcgggaccaccgggatcgaccccgaccgcagtttccgcgacctcggcttc
agctcgctgatgaccgtcgagctgcgcgacgaactggtcacggtgaccggggtcgcactg
ccccggaccgtgttgttcgaccacacctcgccccgtgcggtggccgaccacctccgcgaa
gcgctggcagggacaccccgtccggtggacgaggggagcgacaaggcgcatcccggtgag
cccatcgcgatcgtcgggatgggctgccggctgcccggcggcgtgcggacacccgaggcc
ctgtgggagctgctctcggccggaacggacgcgatcagcggattccccgacgaccgaggc
tgggacctcgacgggctttacgaccccgaaccggggacgacggggaaggcgtacaccagg
gcgggggggttcatcgacgcggcggacttcgaccccgagttcttcggcatctccccgcgc
gaggcgaccgcgatggacccgcagcagcggttgctgctggagacggcctgggaggcgctg
gaggacggtgccgtcgacccggccacgctgcgcggcagccaggcgggcattttcgtgggc
gtcaccgctcaggagtacggcccccggctcgccgacgcatccggcggacacgagggctac
gcgctgaccggcacctcggtcagcctggcctccggccggatcgcctacgtactcgggtcg
cagggcccggccgtcaccgtggacaccgcgtgctcgtcgtcgctggtcgcgctgcacctg
gcggtccagtcgctgcggcagggcgagagttcgctggcgctcgcaggcggtgcggcgatc
atgccgggtcctgggatgttcgtggagttcgcgcagcagcgcggcctgtcgccggacggc
cggtgccggtcgttcggtgccgacgcggacggaacgggctgggccgagggcgtcgggatg
ctcgcgctggaacggctgtccgatgcacgggcgcgcggccacgaggtcctcgcggtcatc
cgcggcacggccgtcaactccgacggcgccagcaacggcctcaccgccccgaacgggctg
gcgcagcaacgcgtcattcggctggccctggccgatgccgggatgaccggcggcgaggtg
gacgcggtcgaggcgcacggcacgggcacccccctcggcgacccgatcgaggcgggcgcg
ttgcaggccacgtacggcagcgaccgcgacgcggatcgaccgctgctgctggggtcggtc
aagtccaacatcgggcacacccaggccgccgcaggcgtcgccggggtgatcaagatggtc
ctcgcgatgcgccacggtgtgctgccgcgcaccctgcacgccgaggttcccacgcctgag
gtggagtggtcctccggcgcgatctcgctgctcaccgaggaaatcccgtggccgggcacg
ggcccgcgccgggcggccgtctcgtcgttcggcatcagcggcaccaacgcccacgcggta
ctggagcacgccccgacctccaccgaacccggcagcgagccagccgacggcccggtgccg
tggctgttgtccgcccccacgccgcaggggatcacccgtcaggccgcgcggctccgcgac
cacctggaggctcaccccgacctcgttcccgccgacgtcgcgctgtccctggcgacgacc
aggacgacgttcccgcaccgggccgccgtggtggcggcgggcgacgacctgctgcgtggc
ctggaacgactggccgcgggcgagaacacgggccgggggaccgcgtccgacggcggggtg
gcgttcctgttcaccggccagggcagccaacgggcaggcatgggtcgggagctgtacgaa
cgcttcccgatcttcgccgccgcgttcgacgccgtgtgcgccgagctggaaccgggcctg
cgggaactcgtgttcggcgccgacggcgacggcctgctcgaacggaccgtgcacgcccag
cccgcgctgttcgcgatcgaggtcgcgctgttccgcctgctcgaatcgtggggggtggtg
ccggacctcctgctcggccactcgatcggcgaggtcgccgccgcgcacgtcgccggggtg
ctgtcgctaccggacgcctgcacgctggtcgccgcacgcggccgcttcatgcaggccgcc
accacgggcggggccatggccgccgtgcaggccaccgagcaggaactggcggaggacctg
gacgcgtctgcggggttggtcgcgctggcggccgtcaacggcccgaactcggtggtggtc
tccggtgactccgaggccgtcgaggcgatcaccgcgcggtggcgggaccaggggcgcaag
acctcgcggttgcgggtgagccatgccttccactcgccgcacatggattcggtgctggcc
gggttcgcggaggtcgtcggcgcgcttccgctcgccgagccgcgtatcccgatcgtctcc
aaccggaccggccggatcgccgaggtgggggagctgacgtcgccggactactgggtgcgg
caggtacgcgaaccggtccggttcctcgacggcgtccgacacctggtggcgtccggcacc
acgacatacctggaactgggcccggacgcgaccctgtccggcatggtccgcgactgcctg
ggtgacgaggccgtcggcgtggcggtgctgccgatgatgcgcaaggaccgacccgagagc
gccacggcgttgactgcactggccgccgcacacggccacggggtcgtcgtcgactggcgt
gcggtccttccggcggcccgtactgtccggctgcccacgtacgccttcgaacgcgggcgg
ttctggctcgaccagcccacgtcgaccggtgacgcccgcgggttggggcagggcatgacc
ggccacccgatgctgggcgcgacggtgagcctggccgatggcaacggcaccgtgttcacc
ggacgcctgtcgctgcgtacccacccgtggctgggtgaccacgtgatcgcgggccaggtc
ctgctccccgcatcggccttcgtcgagttggcgttgcgggccgggcaggaggcgggctgc
gacgaggtggccgagctgactctggaggcaccgctggtcctgcccgccgaggacggggtg
cgactccaggtcgcgatcgacgccccggacgccgccggccaccgcaggctgaccgtgtac
tcgggcgacgagcgggtcgacggctggacccggcacgcgaccggcctgctgagctccgcc
cgtggcccggccggcgccccggcgccccggcctgcgggcgtgctggccgaacccgacgac
gtctactcgcgactggacgcgctcggctaccggtacggacccgtgttccaggccctgcaa
cgggtaggtgcttcgggcgccgacctgttcgccgaggtcagcctgccgagtggcacacgt
gcggacgacgtgcggggcttcggcatccatcccgcgttgcttgacgccgtgctgcacccg
ctcgtgctggccgccgccgaggaggacggcgaactccgcctgccgttcgcgtggtccgga
gtgcgcctgtacgccaccggtgccacctggctgcgggtccgcgcgacccgcaccggcccg
gagacgtactcgctgctcgccacggacgctgacgacaggccggtcgtcggcgtggcgtcg
ctcgtgctgcgtcctgttccggtggagcggatcgcccaggccgccgcgccgggcaacggg
aacctctaccgaccgaccctcgtcccgatcccgctcgccgtccagcccgcagacgtgatc
gacaccgtcgtgtgggtggaaccgggcacaccggccgaggtgaccgcccgtgcgctgcgc
agcgcacgggaatggttggcgcagccgggaaccgcaggccggctcgccttcgtcaccagg
gctgcggtgcacgccccggcaggcccggacctggcgggtgccgccctgtggggcctggtc
cgcagcgcgcagacggagaacccccgccgcttcgcgctcgtcgacctggacgactcgtcg
gagcacctgctcgcctccgccctgtctgcgggcgaggaccggctcgtgctgcgcgacggg
caggcctacgcgccacggctccaccgcgcccggccggaactggaggacgtaccgaccgtt
ctcgattcgcacggcacggtgctgatcaccggtggtaccggcgtgctaggcggcatcttc
gcccgacacctggtgaccgcgcacggcgtgcgccacctactgttggtcagccgcagcggg
cccgccgcgccgggagcagccgacttggcggccgcgctggagtccctcggtgccgaggtg
cggatcgaggcctgcgacgccgccgacgccaaggccctggacgaactgctggccaccgtt
cccgccagccaccccctcaccggcgtgatccacgcggccggtgtgctggatgacgcgccg
atcgagacccttgatccggaccggctggccgtggtgctgcgggcgaaggcggacgcggcg
tggaacctgcaccgggcgaccgccgggaccgacctcgcggccttcgtgatgttctcctcg
atcgccggccacatcggcagtgcgggacagggcgcctacgccgccgccaaccgctacctc
gacgcgctcgccgagcagcgccgggccgccgggctgcccgcggtctcgctggcctggggg
ctgtgggacctggacaccggcatggcgggcggtctcggccccgccgagcgggccaggtgg
gcacggggcggggtcaccccgctgccggtccggtcggggctggagctgttcgacctggca
ctcgggggtggcgccgacgccatcctggtgccggtgacgctcgccctggcgggagtgacc
gcgctgccggacgagttccgtgaccttgttcgggctccgctgcaccgtgcgacggcaccg
gctgcggggggctcctcctgggccgcgcgcacggccgcgctccccgcgctggaacgtgaa
cgcgagatccgcgccttggtccggtccgccgtcgccgccgtgctggggcacgacggcagc
acaccggccgaccccgaccgcacgttccgggaaatcggcttcgactccctgaccggcatc
gaactgcgcaaccacctccacgccgccaccgggatccggatctcgacgacggcgaccttc
gaccacccgacccccacccggctcgcggaccacctggtcgagcagttgaccggcgcccgc
tccgccgagccgtccgtcgtgcgggcggcggactccgacgacccgatcgcggtcatcggc
atggcctgcggttacccgggcggggtacgcgggccggaggacctctggcggttggtgtcg
gagggcgtcgacgcgatcggcgacttccccggcgaccgcgggtgggatgtcgacggcctc
tacgatcccgaccccgaccgaatcggcacgtcgatcacccgcgagggcggcttcctgcac
tcggcggccgacttcgacccggagttcttcgggatcagcccgcgcgaggcgctggccgtc
gacccgcagcagcggctgttgctggaggcgtcctgggaagccgtggagcgggccgggatc
gacccggtcagtctgcgcggcagccgcaccggcgtgtacgccgggatgatgtaccacgac
tacgcctcccggctgccggtcgcaccggacgggttcgaggggcgactgctgaccgggaac
accggcagcgtggcgtccgggcgggtctcgtacaccctcggtctcgaaggcccggcggtc
accgtggacaccgcctgttcgtcgtcgctggtggccatgcacctggccgcccaggcgcta
cggagcggcgagtgctcgctcgcgctggcaggcggggtgacggtgatgtccaccccgaac
accttcgtggagttcagtcgccagcgtggactcgcgccggacggccggtgccgcgcgtac
gccgaggacgccgcaggcaccggctgggccgagggcgtgggcgtgctgctgctggaacgg
ctgtccgacgcccggcgcaacgggcaccccgtcctggccgtggtgcgcggcaccgcgacc
aaccaggacggtgcgagcaacgggctcaccgcgccgaacggacccgcgcaggagagggtg
atccggcaggcactcgccaacgccgggctgacgacggcggacgtggacgccgtcgagggg
cacggcaccggcacccgactcggtgacccgatcgaggtgcgggcgctgatggcgacctac
gggcaggaccggccggaggaccggccactgtggctggggtcgctgaagtcgaacatcggg
cacagccaggccgcggccggggtcggcggcgtgatcaagatgatcatggcgatgcggcac
ggagtgctgccccgcaccttgcacgccgacaccccgtcgacccggatcgactggtcggcg
ggcgccgtgtcgctgctcgccgacgccgtgccgtggcccgaggccgaccgcccgcgccgg
gccgccgtctcctcgttcggcatcagcggaaccaacgcccacgtcgtgctcgaagctcac
gaagtgactgcggccgaaccggtcccgcccgcaccgcccgtcgtaccgctgccgctttcc
gctcggacggacgccgccctgcgcgcgcaggccgggcgactgagcccgttcgtgacggaa
ctcccgctcgccggtctcgccgccacgatggccgggcgctcgatcatggaccaccgggcg
gtggtcctcggcaccgaccgagacgaactgcgggccgggctgaacgcggtcgcacgggac
gaccagaccgccacggacctgcaggtggtgcgcggcgtcgccgtcgcgcgcggtgcgacg
gtgttcgtcttccccggccagggcagccagtggcaggggatggccctcgacctgctcggg
agttcgcccgtgttcgccgagcgcctgaccgagtgcgccgccgcactggaacgccacgtc
gactggtccgttctcggcgtgctgcgcggcgaacccggcagcgccgacatcgaacgggtc
gacgtggtccagccgctgctgttcgcggtgatggtgtcgctggccgagatgtggcggtcg
tcaggagcggagcccgccgcagtggtgggccactcacagggcgagatcgccgcagcgtgc
gtggcgggcgcgttgtcgctcgacgacgcggcacgggtcgtggcgctgcgcagccgggcg
ctggtcgcgctcgccggtggcggcggcatggtgtccctcccgctgaacgtggaggaggcc
gaggcccgcatcgccgagtgggccgggcaactatcgatcgcggcggtcaacgggccccgg
tcggtcgtcgtctccggcgacgcggccgcgctggatgccctcatgagcgcctgtgacgcc
gacggggtgcgggctcgccgcatccccgtcgactacgcctcgcactccgcgcacgtggag
gcgatcgaggcacgactggccaccgacctcgccgggctgtccccgcgcccggccgcagtg
ccgttctactccacggtgaccgccggggaaccggacacgagcgcgctcgacggcggctac
tggtaccggaacctgcggcagaccgtccgactcgacgagaccgtgcgactgctgctggac
cgtggccaccgaatgttcatcgaggtcagcccgcatccggtgctgaccatcggtgtggcc
gagacggtcgaggacaccgggctgcaggacgagaccgtggtcatcgggacgctccggcgc
gaccaaggctcgctccggcggttcctggcgtcggcggccgaggcgtacgtgggcgggctt
ttgatcgactggcggcggctgtcgggcgtcgtcggcgcaccgcacgtggaactcccgacg
tacccgttccagcggagccggtactggttggacgcttcgctcacacgctccggcgccgga
accggcctgaccgtcctcgaccacccggtgctggcgggcacggtcgtcgtcgcggacggc
gagaccgagctgttcaccggtgaactcggcctggccactcagccgtggctggcggatcac
cgcgtcggcgggaaaaccctggttccgggtacggccttcctcgacttggtggcgacagcg
gcggcccacgcggactgcgccgtcgtagaggacctcaccctggaaacgccgatgctggtc
ccgagcaccggcaccgtgcgcctgcagctcctcgtcggcgccgccgactcgacgggccgc
cgcgcggtgtccttgcactcgcgttccgggggcgagccgcactggcagtgtcacgccacc
gggactctggccccggccacgtcgcaggcgccgcccgccggggggacctggccaccccgc
gacgccatcgcgatcgacctcgacgacgcctacgcccggctcgccgaccgcgggctccat
tacggacccgcattccagggcctgcacgccgcgtggcgcgacggggagcacacgtacgcg
gagatccgcctgcccgagtccgttgccgcaggcggcttcggtcttcacccggcgctgttc
gacgcggccctgcacccgctcgccctcgaccacgacggcgggcacgggaccgtgccgctg
ccgttcacctggcgcggggtgagcctgtaccgcaccgacgcgactgtcctgcgggttcgg
ttgacctccgacgacaccggcaccgccatcgtcgcccacgacgccgcgggcgcaccggtg
ctccaggccgagtcgctcgtcctgcgctcggcccggcttgacggcgtcggcggcgccccg
ctctaccgcctcgactgggtcccggtccccccaatggacgagcccggcacggacggctgg
gaaggggaggtcgccgtcctcggcgtcgaggcggacggcgatgtcgtcgcccgcactcac
cgggccacacaagcggccctcaacctcgttcaggcacggctcgccacgaacgagagcggt
ctgctggtcgtcacgagcacggctgtcgcggtgagccccgatgagacaccggacccggcg
gccgccgccgtgttgggcctcatccgcaccgcccagaccgagcacccggacagcttcctg
ctactcgacctgcccgcaggtgaagaacccaccgccgagctgctcgccgccgcgcgagcc
agcggcgaaccccagctggccgcccgaggaggaaagctgtatgccccaaggctcgccgcg
cttccgaacggcaccgggaccacggactgggaaccggacgggaccgtgctcatcaccggc
ggcaccggcgtcctcggcgccaccctggcccgacacctggtcacccggcacggcgtccgg
aacctgatcctggcgagccgcaggggccccgccgcaaagggtgcggaagcactcgtcgcc
gagctgaccgcagcgggtgcccgtgtcaccctggctgcctgcgacgccgcggaccgcacc
gcgctggccgcgttgctcgccgccgtgcccgccgagcacccgctcaccgccgtggtgcac
acagccggggtcctcgccgaccacaccgtggaaaacctcgacccggatcggctcgccgcc
gtgctgcggccgaaggtggacggcgcctggcacctgcacgagctcacccgcgatctcgcg
ccgcagctggccggcttcgtcgtgttctcctcgttcgcgggcacgctcggcacggcgggc
caggcgaactacgcggccgccaacgccttcgtcgacgcgctcgcccagcaccgcacgacc
gccggactgccggcgacctcgctggcctggggattgtgggcggagggcaccggcatgacc
ggtcacctcggcacggccgcgctggccgggctcgccgggtccggcatcgcggccatcgac
accgatcagggcctcgcgatgttcgacacggccgtcgcgggcggcctcgcggtcaccgtc
cccgccctgctcgacctgtccgccctgcgtacccaggcgaccgagggcacgttgccaccg
atcttccggaacctggtccgcggcgtgcgccgccgggccaccgcgatcgcccggaccgga
gaaaccccggaggagcggaagaatcgactgctcgacctgacgaccggctcggtcgccgcc
gtcctcggccacgcctcaccggagacgatcgacatccggcggcccttcaccgagctgggc
ttcgactcgctgctcgcggtgcaactgcgcaaccgactcaaggcggccaccgggctcgga
ctgtccgcgaccatcgtgttcgaccacccgaccgtccaagccctcgccgctcacctcgac
gcgcagctcgacggcgggactgcggcggagaccggagacgctcccgcacgggcgggcacc
gacgagccgattgccatcgtggccatggcctgccggttccccggcggggtgagcacaccg
gaggacctgtggcagttggtggccgacggcgtcgacaccacctcggagttccccggcaac
cggggctggaacacggccgacctgtacgaccccgacccggacagcacgggccggacgtac
gcgcgggccggtagcttccttcacgacgcgggcgacttcgacgccgacttcttcggcatc
agccccaacgaggcgctcgccgtcgacccccagcaacggctgctcctggaaaccgcgtgg
gaggccttcgaacgcgcgggcatcgacccgaactcgttgcgcggcagcgacaccggtgtc
ttcgccgggatcatgctgcacgactacgcgccgtccgcgggaggcccggcgaacctggag
ggcaagctcgcggtggcgaacgcgccgagcgtcgcctcaggccgcgtctcgtacaccttc
ggcctgcagggcccggcgatcacggtggacacggcgtgctcgtcgtcgttggtctcgctg
cacctggcagcgcaatccctgcggcagggggagtgctcgctcgcgctcgccggcggtgcc
acggtgatggccaccccagagctgttcgtcgagttcagccggcaacgcggtctctcggcc
gacggccgatgtaagtccttcgcgggcgcggcggacggcaccggctggggcgagggcgcg
ggctggctgctgctggagcggctgtccgacgcgcgacgactcgggcacgaggtgctggcc
gtggtccgtgggtccgccgtcaatcaggacggcgcctccaacgggctgaccgcgccgaac
ggccccgcccagcagcgggtgatccgccaagccctggccagcgcccggctcaccgccgcg
gacgtcgatgtcgtcgaggcgcacggcacgggcacccggctgggagatccgatcgaggcc
caggcgctgctggcgacctacggccaggaccgggatgagccgttgttgctggggtcggtc
aagtcgaacatcggtcacacccaggccgcggccggggtcgccggtgtgatcaagatggtt
ctcgccctgcgacacggcgtggtcccgcgcacgctgcacgtcgacgagccgaccccggag
gtcgactggagcgcgggtgccgtcgaactggcgacatcgcaggtgtcctggccgaccgtg
gaccgggtccgccgcgcggcggtctcctcattcggggtgagcggcaccaacgcccacgtg
gtgctggagcaggccccgaccgttgacgccccggtgggtaaccggccctccggcgtggtc
ccgtggacgttgtcggcaaagaccgatgcggccctgcgggcccaggccgcccggctgcgc
gcattcgtacaggcacattccgacctcgatccggccgatgtgggttggtcgttggcgacg
gggcggtcggtgttcgatcggcgtgcggtggtggtgggcggtgatcgggatgccttgctc
gatggtctgacggcgttggcatccggcggtcctgtcgtcggggtcggtaccggtagggcg
gtgttcgtctttccgggtcagggttcgcagtgggtgggtatggcggtggggttgatggac
tcctcgcccgtgttcgcggcgtcgatggatgagtgtgggtcggcgctgtcggagttcgtc
gagtggtcggtggtggatgttctacgtgccggcggcgagctcgagcgtgttgatgtggtg
cagccggtgttgtgggcggtgatggtgtcgttggctgcgctgtggcgttcttttggtgtg
gagcctgttgcggtggtgggtcattcgcagggtgagatcgctgctgcggtggtcgccggt
gcgttgtcgttgcgggatggtgcgcgggtggtggcgttgcgcagcagggtgttgctgggt
atcgccggtgacggtggcatggtgtctgtcgcgttgtcggtggatgaggtgcgtgcccgg
ttggtcgacgggatcggggttgctgcggtcaacgggccgggttcggtggtggtgtcgggt
gcggcgggggtgttggatcggtggcaggccgaggtggaggctgctggggttcgggtgcgt
cggataccggtggactacgcgtcgcattcggttgatgtggagcggttgcgtgacgagatc
ctgaaggtgttggctccggtcacgccgcggtcggtggagctgccgttctactcgacgctg
accggcggggtgctcgacacctcggggttgaacgccgagtactggtatgagagcttgcgt
cggccggtgctgttcgagcaggcgaccagacagttgttggaggacggtcacgatctgctg
atcgagtccagtccgcatccggtgctggccgtcggtatcgaggagaccatcgaggcggcg
gggagcaaggccgcggtggtcggctccctccgccgcgacgacggtggcctcgatcgattc
ctggcctcgctgggcgaggcgtggaccaggggagccacacctgactggtctgcggtgctt
gcaggtggccgtcgggtcgaactgccgacgtacgcattccagcgggtgaggttctggctg
gagaaccgtcccgccaccgctcccgtggatgccctcttctgggacctcgtcgaccaaggc
gaggtggacgccatggtctcgggcgtgggtcccgaggccgagcaggagaggtccgcactg
acgaccgtgctgcccatgctcgccacctggcgccgtcgccagcaggaggagaccttccgc
taccgggtgacgtgggtgcccgtccccgagaatccggtcgaacccggcccgtggctggtc
ctggtcccggaggagcccacggaacacgtggcggggtgcctcgacgccctgaacgccctc
gggtcgaagatcatgccgatcgacccgcgttcgggcctcggtgacctgtcagggcccgaa
ccgaggggcgtgctctcgttgttggcactcggcggcaagaccgctctggagaacgccgca
gaccttgctcgcgtgacacgggagttgggcgaggcgggtgtcggagccccgctatgggtc
gccacgagcggcgcgaccgggcccggcgtcccgcacgcccccgagcaggcgatgctctgg
ggcctggggcgttccgccgccgtggagatcccggaccggtggggcggtttgatcgatatt
ccggccgagcccacccccgagacctggcggcacttcgctggggcgctcggcggcgacgag
gaccaggtggccgttcgggcgtccggggttctcgcccggcgattggtccggtcgacaggg
cccagcaagggctggcagccgcgtggaaccgtcctcgtcaccggcggcaccggcgcggtc
ggtagggaagtggcccgatggcttgcgacacaaggggtcgagcgcctggtactcaccagc
cgcagtggcggaaacgcgccggaggctggaccgctggcagccgaactggccgccgtgggc
gtgagcgtcgcggtggaatcctgcgacgtggcggaccggcaggcactggccgtgctcctg
gaacggcacacgcccaacgccatcatccacgccgcaggggcgctggacgacggtctggtc
ggcagtctcaccgcagcccggttcaccgccatcgccgcctcgaaggtcgacgcggtcaag
aacctgtacgaactgacccgtgataccggcctcgacgcgttcgttgcgttcacctcgctc
gccggggtggtcggctcgcccggccagggcaactacgccgcggccaacgccgcagtggat
gccctgatcgagacgtaccgggtccagggcttccccgcgacctcgatcgcttgggggctc
tgggcgggcagcggcgccgacgacggcaccagcggacggcacctcggggcacgggggatc
gtgccggtggaaccggctcggatgctcgactcgctcggctgggcagtcggcaacgacgag
gcctcgacgacggtcgcccggatcgactggccgcgcttcaccctgctctctgcggccacc
cgcctgtacgacgacctcgtggacacccgacggcaggcggacgagcccgctgcccaggag
gccgaggccacgtcgctggccgaccggctcgccctcctgccgcccgccgaacgcaaccgt
gaggtcatcgccctcgtgcgcagggaagccgcggtggcgctggggcacgccgacgcggaa
ctgatcgagtccggccgggcgttccgcgaactcgggttcgactcgctcaccgccatgcag
ctccgcaaccggctggtcgccgtcaccggcctggacttgccatccgcgctggtcttcaac
tacccgaacaccaccgcgctggccgagcacctgctctcccgcctgatacccgacaccggc
gcggaccacgacggggtgctcggcatcctcgaccgactcgactcggcactggcgcacgcc
gtggacggggacgtgctgcgagaggtgtccggtcgtctggaggcgctcctcgcgcgatgg
cgggaaagggacacctcctccgactccgtgctcgaagaggacgccatcgagtccgtctcc
gatgacgagatcttccgcctcatcgaccagaacttcgacctgtga

DBGET integrated database retrieval system