KEGG   Actinoalloteichus hymeniacidonis: TL08_20495Help
Entry
TL08_20495        CDS       T04472                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
ahm  Actinoalloteichus hymeniacidonis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AOS64890
UniProt: A0A1D8C1G8
LinkDB All DBs
Position
4843137..4844258
Genome map
AA seq 373 aa AA seqDB search
MALPLSSPIEPMLASPASELPVGDYLFEPKWDGFRCLVFRAGEEILLQSRTGRSLNRYFP
EVLDRLAEALPEDVVLDGELVVARAGRLDFDALGERIHPAQSRVRMLAEATPAEFIAFDI
LALGSRDLRGEPLSLRRDLLVDFDARVGGSALRLTPATTDPDTALVWFDLFEGAGLDGVV
CKLLDGGYTPGRRSMIKIKHERTADCVVAGLRWHAKTPPGTAVGSLLLGLYDDHRVLHHV
GVVGAFTAARRRALAEEFDGLRIDRDSDGGVEATEEHPWLGEHASDGRRVPGGESRWRKG
SAQWVPLRPERVVEVAYDHTEGAEPARFRHTTRFRRWRPDREPATCRYDQLDEPVRYDVN
AVLAGEVRQQPGS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttccactgtcctcgccgatcgagccgatgttggcgagcccggcctcggaactc
cccgtgggcgactatctgttcgagcccaagtgggacggcttccgctgtctggtgttccgc
gcgggtgaggagatcctgttgcagtcccgcaccgggcgctcgttgaatcggtatttcccc
gaggtcctcgatcgcttggccgaggcgctacccgaggatgtcgtcctcgacggcgagttg
gtggtcgcccgagcgggccggttggatttcgacgccctcggtgagcgaatccatccggct
cagagccgggttcgcatgctcgccgaggccacccccgccgagttcatcgctttcgacatt
ctggcgctcggcagccgggacctacgtggtgagcccttgagcctgcggcgcgacctgctc
gtcgatttcgacgcccgagttggtggctcggcgctgcgactgaccccggcgaccaccgat
cccgatacggcgctggtctggttcgatctgttcgagggcgccggtctggacggcgtggtc
tgcaagctgctggacggtggttacaccccagggcgccgcagcatgatcaagatcaagcac
gagcggaccgccgattgtgtggtcgccgggctgcgctggcacgccaagacaccgcccggt
acggcggtgggttcgctgttgctcgggttgtacgacgaccaccgggtgctgcaccacgtc
ggtgtggtcggcgccttcacggcggcgagacggcgagcgctggccgaggaattcgacgga
ctccggatcgaccgcgattccgacggcggtgtcgaggccaccgaggagcatccctggctc
ggcgagcacgcctcggacggacggcgggttcctggcggggagagtcggtggcgcaagggc
agcgcgcaatgggtgccgctgcggccggagcgcgtggtcgaggtcgcctacgaccacacc
gagggggccgagcccgcccgattccgacacaccacccggttccgccgctggcggccggat
cgcgagccggcaacgtgtcggtacgaccagttggacgagccggtccgctacgacgtgaac
gccgtactcgccggggaggtccggcagcagccgggatcctga

DBGET integrated database retrieval system